BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0290 (720 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13290.1 68417.m02078 cytochrome P450 71A19, putative (CYP71A... 27 9.5 >At4g13290.1 68417.m02078 cytochrome P450 71A19, putative (CYP71A19) Identical to Cytochrome P450 (SP:Q9T0K0) [Arabidopsis thaliana]; similar to cytochrome P450LXXIA1, Persea americana, M32885 Length = 490 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 435 PGGEWLPSTMDVSNARGRAKPLSTVDSLFD*FM 337 P GE++PS + RG+ + VD FD F+ Sbjct: 219 PIGEYIPSLSWIDKIRGQDHKMEEVDKRFDEFL 251 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,954,195 Number of Sequences: 28952 Number of extensions: 283300 Number of successful extensions: 662 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -