BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0289 (817 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 3.7 At5g18000.1 68418.m02111 transcriptional factor B3 family protei... 29 4.9 At1g14740.1 68414.m01762 expressed protein 29 4.9 At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 28 8.5 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 691 LSEDRNLAWSKRAKAGLIQMFSTHRDCESTAYRSFSIK 578 LS R W RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 282 LSSRRIDRW--RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At5g18000.1 68418.m02111 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 307 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +3 Query: 462 RNDRKSRHRRIKKQRRMNAWLPQASYPC 545 R +RKS ++ +KK+ + +W ++S+PC Sbjct: 135 REERKSIYKDVKKEEEIESW-SESSHPC 161 >At1g14740.1 68414.m01762 expressed protein Length = 733 Score = 28.7 bits (61), Expect = 4.9 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Frame = -1 Query: 343 YCSVREEPQFRTFGSCTRP-SGRWCEATIRGLCLNASKAEASLAESGKDMLTVEPRESGG 167 + +VR F S + P SG E T+ LC N+ K SL + GK+++T S Sbjct: 46 FLNVRSNNLDGGFSSKSSPRSGN--ELTLSYLCENSGKLAESLGQKGKEVVTFSENSSYD 103 Query: 166 SK--QCDFTSRVSHSKRETRRRS 104 K + DF + + ++R++ Sbjct: 104 DKWVERDFFNLREMNPNSSKRKA 126 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -1 Query: 283 GRWCEATIRGLCLNASKAEASLAESGKDMLTVEPRESGGSKQCD 152 G W + + +K + ++ + GKD LT+E E G+ + D Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,250,213 Number of Sequences: 28952 Number of extensions: 387479 Number of successful extensions: 1047 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1047 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1863090400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -