BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0286 (658 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_03_0177 + 15140414-15140777,15142067-15142239 31 1.1 07_03_1231 + 25047067-25047262,25047876-25048045,25048897-250490... 29 3.3 08_01_0141 - 1115794-1117584,1117803-1117897,1119557-1119821 28 5.7 01_01_0094 - 730484-731570,732030-732715 28 5.7 01_06_1087 - 34430521-34430899,34432336-34432806,34432926-344331... 28 7.5 11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840,377... 27 9.9 01_01_0097 - 741881-742977,743100-743320,743438-744156 27 9.9 >03_03_0177 + 15140414-15140777,15142067-15142239 Length = 178 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = -1 Query: 304 LDGSISLSPLYPVPTIDCTSESLRSSIRVSPDFDLTRHSSPSFGSQHLCSE 152 +DG+ + SP P P +DCT+E+L+ + D+ ++PS S+ C E Sbjct: 24 VDGATASSPA-PAPAVDCTAEALK--LADCLDYVTPGKTAPSRPSKLCCGE 71 >07_03_1231 + 25047067-25047262,25047876-25048045,25048897-25049030, 25049122-25049369,25049799-25049904,25049992-25050130, 25050258-25050385,25050472-25050733 Length = 460 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -2 Query: 516 LLTKLAHLAPSSDLRLHRSSKPEFSPI 436 +L L +LAP DLR+ SSKP F I Sbjct: 258 MLETLVNLAPVLDLRIFSSSKPSFIKI 284 >08_01_0141 - 1115794-1117584,1117803-1117897,1119557-1119821 Length = 716 Score = 28.3 bits (60), Expect = 5.7 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -2 Query: 609 CCHERPTPFMVSHERFLGALTLRLVHPTAPVLLTKL 502 C E PF HE ALTL + PTA L+ KL Sbjct: 324 CIRELAVPFF-HHEVVKRALTLGMESPTAEALIVKL 358 >01_01_0094 - 730484-731570,732030-732715 Length = 590 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 642 LSGFRLPWPPSCCHERPTPFMVSHERFLGALT 547 + G +LP P C + P P +V RF LT Sbjct: 552 VDGLQLPSRPFFCDDEPLPLLVDSYRFSSELT 583 >01_06_1087 - 34430521-34430899,34432336-34432806,34432926-34433112, 34433470-34433599,34433794-34434125,34434566-34435050, 34435185-34435752,34436579-34436640,34437569-34437636 Length = 893 Score = 27.9 bits (59), Expect = 7.5 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -1 Query: 433 KFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGNF-GRNQLLDGSISLSPLY 272 K E LRSF + LP K+ I A++ GN+ GRN GS L L+ Sbjct: 93 KQEETLRSFPDGQRNCYTLPTNRSKKYLIRATFTYGNYDGRNSSESGSPFLFGLH 147 >11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840, 3778828-3778898,3778975-3779213,3779306-3779383, 3779734-3780156,3780416-3780661,3780886-3780978, 3781480-3781527 Length = 571 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 258 IVGTGYRGERLIEPSSSWFRPKFPSG 335 + GTG + PSS+WF P+ SG Sbjct: 14 VFGTGPLPPASLSPSSAWFDPELSSG 39 >01_01_0097 - 741881-742977,743100-743320,743438-744156 Length = 678 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 642 LSGFRLPWPPSCCHERPTPFMVSHERFLGALT 547 + G +LP P C + P P +V RF LT Sbjct: 640 VGGLQLPSRPFFCDDEPLPLLVDSCRFSSELT 671 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,713,658 Number of Sequences: 37544 Number of extensions: 417860 Number of successful extensions: 951 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 951 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -