BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0284 (695 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g07700.1 68418.m00883 myb family transcription factor (MYB76)... 31 0.73 At1g76965.1 68414.m08961 glycine-rich protein 31 0.96 At4g18890.1 68417.m02785 brassinosteroid signalling positive reg... 30 1.3 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 3.9 At5g42370.1 68418.m05159 expressed protein 29 3.9 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 3.9 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 28 5.1 At3g50750.1 68416.m05554 brassinosteroid signalling positive reg... 28 5.1 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.1 At4g14920.1 68417.m02292 PHD finger transcription factor, putative 28 6.8 At1g08910.1 68414.m00991 zinc finger (MIZ type) family protein s... 28 6.8 At5g60000.1 68418.m07524 hypothetical protein 27 9.0 At5g22390.1 68418.m02612 expressed protein 27 9.0 >At5g07700.1 68418.m00883 myb family transcription factor (MYB76) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 338 Score = 31.1 bits (67), Expect = 0.73 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 506 NTNSLKRT*RTNIDQTRHRPASASRPNPTRP 414 NT+ KR ID H+P ++S PNP P Sbjct: 109 NTHLKKRLIDDGIDPVTHKPLASSNPNPVEP 139 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 30.7 bits (66), Expect = 0.96 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 462 DPAPARIRFPSKPDTPRSSEPILIPKLRIQFAD 364 DP A + FP KP+ P P +P+L + F D Sbjct: 92 DPGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At4g18890.1 68417.m02785 brassinosteroid signalling positive regulator-related contains similarity to BZR1 protein [Arabidopsis thaliana] gi|20270971|gb|AAM18490 Length = 284 Score = 30.3 bits (65), Expect = 1.3 Identities = 23/94 (24%), Positives = 43/94 (45%), Gaps = 3/94 (3%) Frame = -1 Query: 449 PASASRPNPTRPGPQSQSL---FRSYGSNLPTSLTYIILSTRGSSPWRPAADMGTNRRDI 279 P+S+S P+PT P + SL ++ SN P+ L + S+P P R + Sbjct: 107 PSSSSFPSPTNPFGDANSLIPWLKNLSSNSPSKLPF-FHGNSISAPVTPPLARSPTRDQV 165 Query: 278 STYIPHLNFKVRREYPDTAANAVLFAFRTISPFY 177 + IP + + P + ++ F+ + +PF+ Sbjct: 166 T--IPDSGWLSGMQTPQSGPSSPTFSLVSRNPFF 197 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 246 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 112 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 185 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 75 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 48 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 179 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 591 RVRIQSET*DDFRECHIKYIQFLRPH 514 R+RIQ DF + + K+++FL PH Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197 >At3g50750.1 68416.m05554 brassinosteroid signalling positive regulator-related contains similarity to BZR1 protein [Arabidopsis thaliana] gi|20270971|gb|AAM18490 Length = 276 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -1 Query: 449 PASASRPNPTRPGP-QSQSLFRSYGSNLPTSLTYIILSTRGSSPWRP 312 P+S+S P+PTR P QS + Y NL +S L S+P P Sbjct: 114 PSSSSYPSPTRFDPNQSSTYLIPYLQNLASSGNLAPLRISNSAPVTP 160 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 241 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 143 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At4g14920.1 68417.m02292 PHD finger transcription factor, putative Length = 1055 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +1 Query: 373 LDP*LRNKDWL*GPGRVGFGREADAGRCRVWSMFVRYVRFSE 498 LD R K +L G G +GFG + RC+ + R + F E Sbjct: 170 LDIEKRRKPYLDGSGNIGFGNQGYRNRCK--KKYKRDMNFDE 209 >At1g08910.1 68414.m00991 zinc finger (MIZ type) family protein similar to putative variable cytadhesin protein (GI:7677312) {Mycoplasma gallisepticum}; contains Pfam PF02891: MIZ zinc finger domain Length = 842 Score = 27.9 bits (59), Expect = 6.8 Identities = 20/93 (21%), Positives = 36/93 (38%) Frame = -1 Query: 461 TRHRPASASRPNPTRPGPQSQSLFRSYGSNLPTSLTYIILSTRGSSPWRPAADMGTNRRD 282 TR PAS + P P P Q + + +N TS+ S S + D Sbjct: 467 TRDSPASQALPMTFSPTPSPQDILATNAANFGTSMPAAQSSQFQGSHVTSLGNCEGRTSD 526 Query: 281 ISTYIPHLNFKVRREYPDTAANAVLFAFRTISP 183 + H+ +V+ ++P + ++ + SP Sbjct: 527 LMARWNHIYGRVQTQFPPAPLSHHHYSMQNQSP 559 >At5g60000.1 68418.m07524 hypothetical protein Length = 149 Score = 27.5 bits (58), Expect = 9.0 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = -1 Query: 335 RGSSPWRPAADMGTNRRDISTYIPHLNFKVRREYPD-TAANAVLFAFRTISPFYRIPWNS 159 +GS PW+P +GT R+ + + + D T + F FYR WN+ Sbjct: 78 QGSRPWQPRTCIGTFYREAHFGMHETPYVLYNSDKDATESKNSCFVVVKDDGFYR--WNN 135 Query: 158 NAQAEKKTLP 129 N + K P Sbjct: 136 NKRIWDKVFP 145 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 120 ERSGKSFLFCLSVRVPWNPIEG 185 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,794,893 Number of Sequences: 28952 Number of extensions: 392253 Number of successful extensions: 1315 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1313 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -