BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0279 (701 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 3.2 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 23 3.2 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 3.2 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 4.2 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 22 4.2 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 7.4 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.7 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 176 RIPWNSNAQAEKKTLPGPLG 117 +IPW+ NA+A K G G Sbjct: 330 QIPWDKNAEALAKWANGQTG 349 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -3 Query: 516 ALHKILTR*NEHNARTSTRPGTGRIRFPSKPDTP 415 +LH T N+ N +P T P P+TP Sbjct: 257 SLHPAETSMNDANRNDCAKPLTQIRNIPGPPETP 290 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 454 HRPHPLPVQTRHAPVLRANPYS 389 +R HPL + + H +L NP S Sbjct: 332 NRCHPLSLSSDHQAMLHHNPMS 353 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 423 RVWTGSGCGRCRVWSMFVRYVRFSELVFY 509 RVW + R+W+ YV+ +E FY Sbjct: 536 RVWPRAAAAAERLWTNPSDYVKQTERRFY 564 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -3 Query: 516 ALHKILTR*NEHNARTSTRPGTGRIRFPSKPDTP 415 +LH T N+ N +P T P P+TP Sbjct: 257 SLHPAETSMNDVNRNDCAKPLTQIRNIPGPPETP 290 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 528 LYIFNMTLAKIVLRFGLDPDPRSP 599 L + + LA +V F DP R+P Sbjct: 444 LLVSKVALASVVKDFVFDPTERTP 467 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 9.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 130 PDLSAASSGHFGLPRRTLVFKDEG 59 P +S++ G VFKDEG Sbjct: 2 PHVSSSGGDDLGSTDEVKVFKDEG 25 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,771 Number of Sequences: 336 Number of extensions: 3923 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -