BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0278 (697 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25750.1 68417.m03707 ABC transporter family protein Bactroce... 30 1.7 At5g63220.1 68418.m07936 expressed protein contains Pfam PF04190... 27 9.0 At5g40320.1 68418.m04892 DC1 domain-containing protein contains ... 27 9.0 >At4g25750.1 68417.m03707 ABC transporter family protein Bactrocera tryoni membrane transporter (white) gene, PID:g3676298 Length = 577 Score = 29.9 bits (64), Expect = 1.7 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 90 VRMERMERVWNRALRYELLHLCTEECIFTQHLCLHTKCFVYTERAS 227 + E + + W + + + + ++ CLH KC V+ E AS Sbjct: 479 ISKESLPKYWLFMYFFSMYKYALDALLINEYSCLHNKCLVWFEEAS 524 >At5g63220.1 68418.m07936 expressed protein contains Pfam PF04190: Protein of unknown function (DUF410) Length = 324 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -2 Query: 228 HWLVQCKQNTSYVNTSVV*KCIPPCTDAVTHILTLCSTLFPYVPFLPIL 82 H LV C + + + + K PC D + LFP VP P L Sbjct: 66 HGLVNCGADLAILFVDTLVKAKSPCNDETLDRIRCIFKLFPRVPVPPHL 114 >At5g40320.1 68418.m04892 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 594 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 115 CGTER*DMSYCICARRNAFLHNTCVYIRSVL 207 CG E D S ICA+ + +H C+Y+ V+ Sbjct: 184 CGLES-DRSPYICAQCDFMIHEDCIYLPRVI 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,471,291 Number of Sequences: 28952 Number of extensions: 261808 Number of successful extensions: 510 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -