BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0276 (703 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4156| Best HMM Match : Ets (HMM E-Value=0) 31 0.90 SB_35605| Best HMM Match : Treacle (HMM E-Value=0.54) 30 2.1 SB_29130| Best HMM Match : Vicilin_N (HMM E-Value=0.17) 29 2.8 SB_39140| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_44015| Best HMM Match : TPR_2 (HMM E-Value=7.3e-07) 28 8.4 SB_58463| Best HMM Match : DUF1168 (HMM E-Value=0.44) 28 8.4 SB_52178| Best HMM Match : Drf_FH1 (HMM E-Value=2.2) 28 8.4 >SB_4156| Best HMM Match : Ets (HMM E-Value=0) Length = 516 Score = 31.1 bits (67), Expect = 0.90 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 4/79 (5%) Frame = +2 Query: 83 PQSPTPNSKTIFTTASSL----PITTIPLKRANRSTRTRRAKSSQMS*TNSYETTR*TAW 250 P S + S T +T SSL P I S+R+ S+ S ++Y+ T W Sbjct: 247 PASVSTQSCTAYTPTSSLYDSRPHPVITSNPNAASSRSTDYSMSRYSNNDAYDRATPT-W 305 Query: 251 SSLPAMAPRLQRYRPGVLP 307 S+ + PRL + GV+P Sbjct: 306 SAPASQTPRLSHMKDGVVP 324 >SB_35605| Best HMM Match : Treacle (HMM E-Value=0.54) Length = 776 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = +1 Query: 55 FVASLYANETSVSDSKLEDDLYNSILVADYDHSVEKSKQIYEDKKSEVIT 204 F ASL A + S SDS EDDL ++ + DH K++ + + +K + T Sbjct: 548 FRASLAAQQDSTSDSSSEDDL----IMDEKDHPQGKARSLSDKQKCKNTT 593 >SB_29130| Best HMM Match : Vicilin_N (HMM E-Value=0.17) Length = 355 Score = 29.5 bits (63), Expect = 2.8 Identities = 20/63 (31%), Positives = 33/63 (52%) Frame = +2 Query: 356 QARRSRFDVGR*EQQRWQTCLRRWQGQDESKSQLEVRSSVGEQQGLLQDCETQRNQYLTL 535 Q R +F++ +QQ+WQ R+WQ Q +SQLE + E Q L Q + + + L Sbjct: 292 QQSRQQFEL---QQQQWQQQQRQWQ-QQLQQSQLEQQQRQQEMQ-LQQQMQIAQTKLLMS 346 Query: 536 AVQ 544 ++ Sbjct: 347 LIE 349 >SB_39140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = +2 Query: 449 SQLEVRSSVGEQQGLLQDCETQRNQYLTLAVQTTPNHNHMAYGANSVEGFKAQWTLQPAK 628 +++E+++S +Q L N T T PN NH+ ANS F Q T + Sbjct: 310 TEMEIQTSSNQQINLYDSYNPNFN---TCNTTTNPNQNHINNIANSYGNFMQQMTTNNSA 366 Query: 629 YDN 637 +++ Sbjct: 367 FNS 369 >SB_44015| Best HMM Match : TPR_2 (HMM E-Value=7.3e-07) Length = 635 Score = 27.9 bits (59), Expect = 8.4 Identities = 21/64 (32%), Positives = 31/64 (48%) Frame = +1 Query: 79 ETSVSDSKLEDDLYNSILVADYDHSVEKSKQIYEDKKSEVITNVVNKLIRNNKMNCME*P 258 E DSK E D+ + + V Y+ +V DK S V+ ++ N L+ NNK P Sbjct: 104 EHESGDSKDESDVLDMVYVL-YNEAVVCYNP---DKASAVLNHIENVLMVNNKQADTSQP 159 Query: 259 TSYG 270 T+ G Sbjct: 160 TTQG 163 >SB_58463| Best HMM Match : DUF1168 (HMM E-Value=0.44) Length = 603 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +2 Query: 392 EQQRWQTCLRRWQGQDESKSQLEVRSSVGEQQGLLQDCETQRN 520 +QQ Q L+R Q Q Q + + + +QQ L Q C T N Sbjct: 295 QQQLLQQHLQRQQQQQRRHQQQQQQQQLHQQQRLEQSCVTANN 337 >SB_52178| Best HMM Match : Drf_FH1 (HMM E-Value=2.2) Length = 404 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 77 TKPQSPTPNSKTIFTTASSLPITTIP--LKRANRSTRTRRAKSSQ 205 T P PTP K + +++P+T +P + + +T+ AK S+ Sbjct: 244 TAPPKPTPPPKPAPSLKTTIPLTDVPPLTSKEKKHEKTKTAKPSK 288 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,485,465 Number of Sequences: 59808 Number of extensions: 384724 Number of successful extensions: 1330 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1321 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -