BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0276 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.1 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 2.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.7 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 22 6.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 6.5 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/45 (26%), Positives = 21/45 (46%) Frame = +2 Query: 428 QGQDESKSQLEVRSSVGEQQGLLQDCETQRNQYLTLAVQTTPNHN 562 Q D+ K+ ++ +QQ L+Q + ++QYL HN Sbjct: 165 QTADKKKASAPLQQLALQQQRLIQQLQITQSQYLLQQGLGLQGHN 209 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 23.0 bits (47), Expect = 2.8 Identities = 14/54 (25%), Positives = 22/54 (40%) Frame = +3 Query: 294 RECFPVEFRLIFAENNIKLMYKRDGLALTLDDENSNDGRLAYGDGKDKTSPKVS 455 R + L E IK+ ++ + EN + G GDG + SP+ S Sbjct: 298 RRRIEIAHALCLTERQIKIWFQNR--RMKWKKENKSKGTPGSGDGDTEISPQTS 349 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 67 LYANETSVSDSKLEDDLYNSILVADY 144 L NET SD + + SI+V+DY Sbjct: 969 LNVNETVCSDYFSQGGVIESIMVSDY 994 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 21.8 bits (44), Expect = 6.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 225 TKQQDELHGVAYQLWLQGSKDIVR 296 TK+Q+ L A + W++ K IVR Sbjct: 92 TKKQEMLVRSAIKYWVERHKHIVR 115 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 6.5 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +2 Query: 95 TPNSKTIFTTASSLPITTIP 154 TP + I + +++PIT++P Sbjct: 841 TPTTSVISMSGTTVPITSLP 860 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,506 Number of Sequences: 438 Number of extensions: 3542 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -