BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0274 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g35680.1 68414.m04436 50S ribosomal protein L21, chloroplast ... 34 0.10 At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (AT... 29 2.3 At4g01630.1 68417.m00212 expansin, putative (EXP17) similar to a... 29 2.3 At3g11440.1 68416.m01395 myb family transcription factor (MYB65)... 29 3.0 At1g53080.1 68414.m06010 legume lectin family protein 29 3.9 At2g23630.1 68415.m02819 multi-copper oxidase type I family prot... 28 6.9 At5g53640.1 68418.m06663 F-box family protein contains F-box dom... 27 9.1 At2g18780.1 68415.m02186 F-box family protein contains F-box dom... 27 9.1 >At1g35680.1 68414.m04436 50S ribosomal protein L21, chloroplast / CL21 (RPL21) identical to 50S ribosomal protein L21, chloroplast precursor (CL21) [Arabidopsis thaliana] SWISS-PROT:P51412 Length = 220 Score = 33.9 bits (74), Expect = 0.10 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = -2 Query: 542 VVEYHWHPFRRIKVGIGVRIPNFEVELVALPQWLEYPTAPHVSI 411 VV + + P ++ + IG R PN + + + + EYP +P+V++ Sbjct: 172 VVVFKYKPKKKYRRNIGHRQPNTRIRITGITGYEEYPASPNVAV 215 >At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (ATHIM) identical to SP|P34881 DNA (cytosine-5)-methyltransferase AthI (EC 2.1.1.37) {Arabidopsis thaliana} Length = 1534 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -2 Query: 605 HFCRAPNTTGIFRCWLCPSLLVVEYHWHPFRRIKVGIG 492 H C+A N + RC L P+ ++H P R++ + G Sbjct: 1381 HICKAMNELNLIRCKLIPTRPGADWHDLPKRKVTLSDG 1418 >At4g01630.1 68417.m00212 expansin, putative (EXP17) similar to alpha-expansin precursor GI:4027891 from [Nicotiana tabacum]; alpha-expansin gene family, PMID:11641069 Length = 255 Score = 29.5 bits (63), Expect = 2.3 Identities = 21/90 (23%), Positives = 37/90 (41%) Frame = +3 Query: 192 RNYFEVDIRQNSQSRRFFVQTWTTGSREIITDNFPIQFRLFYNDRAIKITDAKYGYSIKL 371 RNYFE+ + N + W GS+ + + Y + + ++L Sbjct: 169 RNYFELVLISNVAGGGEISKVWIKGSKSNKWETMSRNWGANYQSNTY-LNGQSLSFKVQL 227 Query: 372 TPGQNKAIINISDNTNVRSSWVFKPLWESN 461 + G KA +N+ V S+W F ++SN Sbjct: 228 SDGSIKAALNV-----VPSNWRFGQSFKSN 252 >At3g11440.1 68416.m01395 myb family transcription factor (MYB65) contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 553 Score = 29.1 bits (62), Expect = 3.0 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = -2 Query: 560 LCPSLLVVEYHWHPFRRIKVG-IGVRIPNFEV-ELVALPQWLEYPTAPHVSIIRDI 399 + P V Y HP + G + + +P+F+ E A QW P+ PH ++ + Sbjct: 302 MVPDSHTVTYGMHPTSKPLFGAVKLELPSFQYSETSAFDQWKTTPSPPHSDLLDSV 357 >At1g53080.1 68414.m06010 legume lectin family protein Length = 283 Score = 28.7 bits (61), Expect = 3.9 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +3 Query: 291 FPIQFRLFYNDRAIKITDAKYGYSIKLTPGQ--NKAIINISDNTNVRSSWVFKPLWESNK 464 F ++F +F + R I D G +I + KA I T ++ W+FK + S+ Sbjct: 150 FAVEFDVFQDKRFGDINDNHVGVNINSVNSKVSEKAGYWIQTRTRGKNQWLFKEVKLSSG 209 Query: 465 LYFKIWNADSNS 500 +K W NS Sbjct: 210 DNYKAWIEYKNS 221 >At2g23630.1 68415.m02819 multi-copper oxidase type I family protein contains Pfam profile: PF00394 Multicopper oxidase Length = 541 Score = 27.9 bits (59), Expect = 6.9 Identities = 17/74 (22%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Frame = +3 Query: 324 RAIKITDAKYGYSIKLTPGQNKAIINISDNT---NVRSSWVFKPLWESNKLYFKIWNADS 494 R + DA ++ ++ P +I+ DN N+RS ++ + +LY ++WN + Sbjct: 459 RGYNLVDAVSRHTFQVYPMSWTSILVSLDNKGMWNLRSQ-IWSRRYLGQELYVRVWNNEK 517 Query: 495 NSYLDSAKRMPMVF 536 + Y +S + ++F Sbjct: 518 SLYTESEPPVNVLF 531 >At5g53640.1 68418.m06663 F-box family protein contains F-box domain Pfam:PF00646 Length = 917 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 411 NTNVRSSWVFKPLWESNKLYFKIWNA 488 +T RS W++ P E N LYF +NA Sbjct: 520 STRWRSLWLWLPCLELNSLYFPDFNA 545 >At2g18780.1 68415.m02186 F-box family protein contains F-box domain Pfam:PF00646 Length = 370 Score = 27.5 bits (58), Expect = 9.1 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = -3 Query: 340 VILIALSL*NNRNCIGKLSVMISLDPVVQVCTKNRRDCEFCLISTSK 200 V L +L+L N N I +L ++SLD QV N CE L+ T+K Sbjct: 76 VSLFSLNL-LNPNPIERLGQLVSLDGGAQVDISNIFHCEGFLLCTTK 121 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,493,095 Number of Sequences: 28952 Number of extensions: 301186 Number of successful extensions: 936 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 936 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -