BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0271 (700 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 2.2 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 3.9 At5g42370.1 68418.m05159 expressed protein 29 3.9 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 3.9 At4g21520.1 68417.m03110 transducin family protein / WD-40 repea... 28 5.2 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.2 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 6.8 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 6.8 At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-P... 27 9.0 At5g22390.1 68418.m02612 expressed protein 27 9.0 At2g20750.1 68415.m02439 beta-expansin, putative (EXPB1) identic... 27 9.0 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 448 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 353 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -1 Query: 235 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 101 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 174 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 64 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +1 Query: 37 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 168 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At4g21520.1 68417.m03110 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to guanine nucleotide-binding protein beta 5 (GI:1001939) [Mesocricetus auratus] Length = 425 Score = 28.3 bits (60), Expect = 5.2 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 211 GGVRILSADLENSXEDVRGDVAPVRTH 291 GG+++ S + ++S +R DV+P RTH Sbjct: 12 GGLKVESGEQKSSWPTMRFDVSPYRTH 38 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 230 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 132 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 457 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 338 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 6.8 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 457 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 338 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-PROT:P08927- RuBisCO subunit binding-protein beta subunit, chloroplast precursor (60 kDa chaperonin beta subunit, CPN-60 beta) [Pisum sativum]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 597 Score = 27.5 bits (58), Expect = 9.0 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = -3 Query: 257 SSXEFSRSAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHF 87 S+ + S S PP R SS + S F T+++ Q++ FP + AA HF Sbjct: 3 STFSATSSMGSSLAPPSNRLSSFVS--ISSSSFGRTQSIAQRKARFPKIYAAKQLHF 57 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 109 ERSGKSFLFCLSVRVPWNPIEG 174 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At2g20750.1 68415.m02439 beta-expansin, putative (EXPB1) identical to beta-expansin [Arabidopsis thaliana] gi|2224913|gb|AAB61709; similar to SP:O04701 major pollen allergen, Bermuda grass [Cynodon dactylon]; beta-expansin gene family, PMID:11641069 Length = 271 Score = 27.5 bits (58), Expect = 9.0 Identities = 23/91 (25%), Positives = 37/91 (40%), Gaps = 1/91 (1%) Frame = -3 Query: 311 LGDLLRIWVRTGATSPRT-SSXEFSRSAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQ 135 L D+ R GA SP E + +R + CS R+ + + + + Sbjct: 66 LVDVKPFKARVGAVSPILFKGGEGCGACYKVRCLDKTICSKRAVTIIATDQSPSGPSAKA 125 Query: 134 KRKLFPDLSAASSGHFGLPRRTLVFKDEGTI 42 K F DLS A+ GH +P V ++ G + Sbjct: 126 KHTHF-DLSGAAFGHMAIPGHNGVIRNRGLL 155 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,979,666 Number of Sequences: 28952 Number of extensions: 348066 Number of successful extensions: 1043 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1043 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -