BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0269 (328 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC072681-1|AAH72681.1| 843|Homo sapiens OTUD7B protein protein. 29 3.3 BC020622-1|AAH20622.1| 427|Homo sapiens OTUD7B protein protein. 29 3.3 AL590487-5|CAI12652.1| 427|Homo sapiens OTU domain containing 7... 29 3.3 AL590487-4|CAI12651.1| 843|Homo sapiens OTU domain containing 7... 29 3.3 AJ293573-1|CAB97494.1| 858|Homo sapiens zinc finger protein Cez... 29 3.3 >BC072681-1|AAH72681.1| 843|Homo sapiens OTUD7B protein protein. Length = 843 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 190 GLTRFPLSLSTI*RNHSQGNGLGESAGKEDPVELDSCLLTMPD 318 G++ S+ ++ R+H NG G E P+E+ C +PD Sbjct: 98 GISHASSSIVSLARSHVSSNG-GGGGSNEHPLEMPICAFQLPD 139 >BC020622-1|AAH20622.1| 427|Homo sapiens OTUD7B protein protein. Length = 427 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 190 GLTRFPLSLSTI*RNHSQGNGLGESAGKEDPVELDSCLLTMPD 318 G++ S+ ++ R+H NG G E P+E+ C +PD Sbjct: 98 GISHASSSIVSLARSHVSSNG-GGGGSNEHPLEMPICAFQLPD 139 >AL590487-5|CAI12652.1| 427|Homo sapiens OTU domain containing 7B protein. Length = 427 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 190 GLTRFPLSLSTI*RNHSQGNGLGESAGKEDPVELDSCLLTMPD 318 G++ S+ ++ R+H NG G E P+E+ C +PD Sbjct: 98 GISHASSSIVSLARSHVSSNG-GGGGSNEHPLEMPICAFQLPD 139 >AL590487-4|CAI12651.1| 843|Homo sapiens OTU domain containing 7B protein. Length = 843 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 190 GLTRFPLSLSTI*RNHSQGNGLGESAGKEDPVELDSCLLTMPD 318 G++ S+ ++ R+H NG G E P+E+ C +PD Sbjct: 98 GISHASSSIVSLARSHVSSNG-GGGGSNEHPLEMPICAFQLPD 139 >AJ293573-1|CAB97494.1| 858|Homo sapiens zinc finger protein Cezanne protein. Length = 858 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 190 GLTRFPLSLSTI*RNHSQGNGLGESAGKEDPVELDSCLLTMPD 318 G++ S+ ++ R+H NG G E P+E+ C +PD Sbjct: 113 GISHASSSIVSLARSHVSSNG-GGGGSNEHPLEMPICAFQLPD 154 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,825,271 Number of Sequences: 237096 Number of extensions: 878238 Number of successful extensions: 1591 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1591 length of database: 76,859,062 effective HSP length: 79 effective length of database: 58,128,478 effective search space used: 1685725862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -