BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0268 (695 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF231130-1|AAL56659.1| 1800|Homo sapiens NUP196 nucleoporin prot... 30 9.1 AF071077-1|AAD22396.1| 1638|Homo sapiens Nup98-Nup96 precursor s... 30 9.1 AF071076-1|AAD22395.1| 1712|Homo sapiens Nup98-Nup96 precursor p... 30 9.1 >AF231130-1|AAL56659.1| 1800|Homo sapiens NUP196 nucleoporin protein. Length = 1800 Score = 29.9 bits (64), Expect = 9.1 Identities = 20/68 (29%), Positives = 32/68 (47%) Frame = -3 Query: 405 PQAENLKKLEFTINSKNPSPDSYSSTLIVDADGRVYKLENNVVLSKAHPVWTSNTPVQAR 226 P A L+ +N K P+P S + V+ GRV +L++++V PV + Sbjct: 893 PPASQTTPLQMALNGK-PAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMP 951 Query: 225 TDQERFSS 202 DQE S+ Sbjct: 952 EDQEPVSA 959 >AF071077-1|AAD22396.1| 1638|Homo sapiens Nup98-Nup96 precursor splice variant 1 protein. Length = 1638 Score = 29.9 bits (64), Expect = 9.1 Identities = 20/68 (29%), Positives = 32/68 (47%) Frame = -3 Query: 405 PQAENLKKLEFTINSKNPSPDSYSSTLIVDADGRVYKLENNVVLSKAHPVWTSNTPVQAR 226 P A L+ +N K P+P S + V+ GRV +L++++V PV + Sbjct: 893 PPASQTTPLQMALNGK-PAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMP 951 Query: 225 TDQERFSS 202 DQE S+ Sbjct: 952 EDQEPVSA 959 >AF071076-1|AAD22395.1| 1712|Homo sapiens Nup98-Nup96 precursor protein. Length = 1712 Score = 29.9 bits (64), Expect = 9.1 Identities = 20/68 (29%), Positives = 32/68 (47%) Frame = -3 Query: 405 PQAENLKKLEFTINSKNPSPDSYSSTLIVDADGRVYKLENNVVLSKAHPVWTSNTPVQAR 226 P A L+ +N K P+P S + V+ GRV +L++++V PV + Sbjct: 893 PPASQTTPLQMALNGK-PAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMP 951 Query: 225 TDQERFSS 202 DQE S+ Sbjct: 952 EDQEPVSA 959 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,036,693 Number of Sequences: 237096 Number of extensions: 2447462 Number of successful extensions: 5283 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5283 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -