BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0267 (502 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 0.76 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 30 1.0 At1g76965.1 68414.m08961 glycine-rich protein 29 1.3 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 29 1.8 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 29 1.8 At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-conta... 27 7.1 At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-conta... 27 7.1 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 30.3 bits (65), Expect = 0.76 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 314 RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 430 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 29.9 bits (64), Expect = 1.0 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +3 Query: 297 TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 431 T+ T SG R++L+ R+ D HD + PFNG T Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 190 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 95 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 1.8 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -1 Query: 256 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 80 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 1.8 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -1 Query: 256 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 80 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -3 Query: 230 NSLKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 105 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.1 bits (57), Expect = 7.1 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -3 Query: 230 NSLKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 105 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,313,137 Number of Sequences: 28952 Number of extensions: 233766 Number of successful extensions: 628 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -