BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0263 (619 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 31 0.13 SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.54 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 5.0 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 6.6 SPAC31A2.13c |sft1||SNARE Sft1|Schizosaccharomyces pombe|chr 1||... 25 6.6 SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosac... 25 8.8 SPAC1805.09c |fmt1||methionyl-tRNA formyltransferase Fmt1 |Schiz... 25 8.8 SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elon... 25 8.8 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 31.1 bits (67), Expect = 0.13 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 584 ARKIRGRPENAGPDPVRNVRRFSRVYI 504 AR I GRPEN G ++N+ R S+V++ Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKVFL 240 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.1 bits (62), Expect = 0.54 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 401 SGCGRCRVWSMFVRYVRFSE 460 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 5.0 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -2 Query: 180 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 43 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 6.6 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 438 TNIDQTRHRPHPLPVQTRHAPV 373 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPAC31A2.13c |sft1||SNARE Sft1|Schizosaccharomyces pombe|chr 1|||Manual Length = 91 Score = 25.4 bits (53), Expect = 6.6 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +1 Query: 484 LKNCIYLIYTRENRLTFRTGSGPAFSGLPRIFLAVXSCRFRFVR 615 LKN Y IY+R N T + +FSGL FR VR Sbjct: 19 LKNVTYDIYSRANDYTRIDRATESFSGLSNSVKKSTENFFRVVR 62 >SPCP31B10.07 |eft202||translation elongation factor 2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 842 Score = 25.0 bits (52), Expect = 8.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 39 RVFDGVTQSGLKTPPRGPGRV 101 RVF G +SGLK +GP V Sbjct: 399 RVFSGTVRSGLKVRIQGPNYV 419 >SPAC1805.09c |fmt1||methionyl-tRNA formyltransferase Fmt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 340 Score = 25.0 bits (52), Expect = 8.8 Identities = 7/27 (25%), Positives = 17/27 (62%) Frame = +3 Query: 474 IMRPQKLYIFNIHSRKSSYVSDWIRTR 554 I+ +K++++++H S+ DWI + Sbjct: 259 ILNNKKVFLYDVHPLHSTSAEDWIHMK 285 >SPAC513.01c |eft201|eft2-1, etf2, SPAPYUK71.04c|translation elongation factor 2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 842 Score = 25.0 bits (52), Expect = 8.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 39 RVFDGVTQSGLKTPPRGPGRV 101 RVF G +SGLK +GP V Sbjct: 399 RVFSGTVRSGLKVRIQGPNYV 419 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,639,065 Number of Sequences: 5004 Number of extensions: 55564 Number of successful extensions: 167 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 167 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -