BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0256 (467 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 4.0 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 22 9.3 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.4 bits (48), Expect = 4.0 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +2 Query: 293 IQALSWVCSISLPCNTFSLKICPTDLMFWQ 382 ++ +SW+ + T+ L + PT + WQ Sbjct: 1022 VRPMSWLLQYFVSFATYWLSVLPTPIGAWQ 1051 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 22.2 bits (45), Expect = 9.3 Identities = 9/45 (20%), Positives = 26/45 (57%) Frame = -1 Query: 437 SLVGLLTADNVRKKLSNMLAKTSDPLDKFLVKKYYKVDLSNKPSL 303 SLV + ++++ + +++AK + P+D ++ + + +S S+ Sbjct: 345 SLVDVKAHPDLQQSVDDLMAKFNTPIDGKTLQYFQNIGISPSSSV 389 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 495,563 Number of Sequences: 2352 Number of extensions: 10761 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -