BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fbVm0256
(467 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 48 4e-08
>AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine
beta-synthase protein.
Length = 504
Score = 48.4 bits (110), Expect = 4e-08
Identities = 23/71 (32%), Positives = 46/71 (64%)
Frame = -1
Query: 464 LLNVTGDNGSLVGLLTADNVRKKLSNMLAKTSDPLDKFLVKKYYKVDLSNKPSLGLVSRM 285
LL ++ DN + G+++ + + + + + K +D +DK +VK+Y KV + +LG +SR+
Sbjct: 404 LLVISDDNIHIKGVISLNKLTSYVISGIVKCTDFVDKAMVKQYVKV--KHSATLGYISRV 461
Query: 284 LDISPYVVVVD 252
L+ PYV+++D
Sbjct: 462 LEKEPYVIILD 472
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,336
Number of Sequences: 438
Number of extensions: 2537
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 12559158
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -