BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0249 (718 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q677T3 Cluster: Putative uncharacterized protein; n=2; ... 36 0.76 >UniRef50_Q677T3 Cluster: Putative uncharacterized protein; n=2; Lymphocystivirus|Rep: Putative uncharacterized protein - Lymphocystis disease virus - isolate China Length = 252 Score = 36.3 bits (80), Expect = 0.76 Identities = 29/103 (28%), Positives = 53/103 (51%), Gaps = 3/103 (2%) Frame = -2 Query: 333 YKLYK*NKSCMKKNEGY*FGQTIRINLNIRQFLIRKFRTLKL-VSEVTLYHNYHTKLDN- 160 + LYK K C+KK +G QT +I I L +KF++ KL + +V + Y N Sbjct: 87 HSLYK-FKECLKKFQGQ---QTCKIPDKIYHELEKKFKSYKLLIPDVESFVKYSKITKNH 142 Query: 159 ILLMDET*KFGTIYY-LFVMYYIIYMYKDVTVHIEMIYLRTFL 34 +L+ + K+ Y + ++YY++ K+ H+E + + F+ Sbjct: 143 VLIFLKELKYSKQYENVNLIYYVLTNKKENVSHLETVLIEDFI 185 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 597,779,982 Number of Sequences: 1657284 Number of extensions: 10787084 Number of successful extensions: 19143 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 18391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19108 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 57851245060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -