BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0247 (492 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0529 - 19107949-19108152,19108857-19109147,19109817-191099... 28 4.7 03_06_0098 + 31641760-31642386,31643173-31644114 27 6.2 >07_03_0529 - 19107949-19108152,19108857-19109147,19109817-19109939, 19110019-19110306 Length = 301 Score = 27.9 bits (59), Expect = 4.7 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -1 Query: 255 RAHHSLIENNFSQTKQRLFLTILLGFYFTILQAYEYIEASFTIADR 118 ++HH ++ Q + L I+ +F++LQ Y Y A ++ ADR Sbjct: 248 QSHHFWLDVEHIQEAIQNVLVIIEMVFFSVLQQYAYHVAPYSGADR 293 >03_06_0098 + 31641760-31642386,31643173-31644114 Length = 522 Score = 27.5 bits (58), Expect = 6.2 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 3/69 (4%) Frame = -1 Query: 258 NRAHHSLIENNFSQTKQRLFLTILLGFYFTILQAYEYIEASFTIA---DRIYGSTFFIAT 88 N A LI+ + + + L + LLGF +L EY+EA + + + S + + Sbjct: 190 NDAKQRLIKQSVPRVLRILKVAELLGFQACVLSCLEYLEAVPWVGEEEENVVSSVQHLQS 249 Query: 87 GFHGIHVII 61 G +G+ I+ Sbjct: 250 GNYGVSPIL 258 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,940,816 Number of Sequences: 37544 Number of extensions: 134013 Number of successful extensions: 250 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 250 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1023611560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -