BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0245 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.0 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 22 4.1 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 690 CALSIFIIAAFIHHGYFDCFVFAHV-EVTVTGQSLV 586 C + FIIAA +H F+C + + VTV L+ Sbjct: 983 CMAAEFIIAALLHPQEFNCLKYGVIYYVTVPSMYLL 1018 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 690 CALSIFIIAAFIHHGYFDCFVFAHV-EVTVTGQSLV 586 C + FIIAA +H F+C + + VTV L+ Sbjct: 983 CMAAEFIIAALLHPQEFNCLKYGVIYYVTVPSMYLL 1018 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 105 ARMFTEVVKNNPGKSVVLS 161 AR FT+ +KN G +V++ Sbjct: 434 ARFFTDCIKNREGFEMVIA 452 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,328 Number of Sequences: 336 Number of extensions: 3009 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -