BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0244 (749 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0456 + 29521282-29522064 30 1.7 03_04_0006 + 16257288-16259522 30 2.3 06_03_0854 + 25400855-25403741,25406174-25407708 29 3.9 05_07_0238 + 28597399-28598286 29 3.9 03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399 29 3.9 05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-28... 28 6.9 03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384... 28 6.9 12_02_0077 - 13288916-13289659,13289689-13289691 28 9.1 12_01_0655 + 5546293-5546478,5546760-5546877,5550697-5550776,555... 28 9.1 06_01_0437 + 3101449-3101521,3101872-3102232,3103766-3103958,310... 28 9.1 05_07_0113 + 27767826-27768284 28 9.1 04_04_0433 + 25163111-25163471,25163943-25164154,25164420-251647... 28 9.1 04_01_0416 - 5504415-5504590,5509032-5509116,5509190-5509322,550... 28 9.1 >01_06_0456 + 29521282-29522064 Length = 260 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 6/45 (13%) Frame = +3 Query: 135 AWQC--PRTGSRGSFKRRRAFPPRHHSARLER----NTVRPPILS 251 AW+C P +G+RG +RRR P S R R +T+RP + S Sbjct: 12 AWRCYSPASGARGGSRRRRRRPAGTTSRRCSRADRLDTLRPYVTS 56 >03_04_0006 + 16257288-16259522 Length = 744 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +1 Query: 322 AKRSP---TYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQWE 474 A+RSP Y T L + ARL T PA SP +AV S + G W+ Sbjct: 162 ARRSPWTVVYGTNLRTGETARLTPRGTFDLSPAVSPSGKRVAVASWQGKPGLWD 215 >06_03_0854 + 25400855-25403741,25406174-25407708 Length = 1473 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 322 AKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVS 447 AKR+PT T P AR +++ +F +P P P +V+S Sbjct: 475 AKRAPTAVTVGAPPPQARTPAAAPAKAF-VSAPAPAPSSVIS 515 >05_07_0238 + 28597399-28598286 Length = 295 Score = 29.1 bits (62), Expect = 3.9 Identities = 24/77 (31%), Positives = 33/77 (42%), Gaps = 4/77 (5%) Frame = +3 Query: 75 AGLRTPALFFDRCT--APVKLPAWQCPRTGSRGSF--KRRRAFPPRHHSARLERNTVRPP 242 AG AL RC P W R G RG +RRR+ P S V P Sbjct: 118 AGAGHDALLDRRCANCGTASTPLW---RNGPRGPKVRRRRRSLSPSLFSISAVHFAVSPT 174 Query: 243 ILSTRTVPPNRVSNETM 293 + + T+PP+ VS +++ Sbjct: 175 YVVSLTLPPSYVSLQSL 191 >03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399 Length = 146 Score = 29.1 bits (62), Expect = 3.9 Identities = 21/67 (31%), Positives = 30/67 (44%) Frame = -2 Query: 235 RTVFRSKRAEW*RGGNARRRLKLPRDPVRGHCQAGSLTGAVHLSKNNAGVLRPAQRGQKP 56 R + +R E G +RR L D +RG+ + A H AG + RG KP Sbjct: 59 RCIAEGRREEEEEVGRSRRGKDLDLDDMRGYGET-----ATHHGLRLAGREEVSPRGGKP 113 Query: 55 RVEQKGK 35 RV+ G+ Sbjct: 114 RVDNGGR 120 >05_01_0041 + 281427-281549,281671-281730,281822-281868,282013-282089, 285368-285440,286193-286281,286665-286711,286805-286885, 287011-287179,287381-287600,287679-287744,288194-288310, 288591-288628,288935-289032 Length = 434 Score = 28.3 bits (60), Expect = 6.9 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +3 Query: 180 RRAFPPRHHSARLERNTV---RPPILSTRTVPPNRVSNETMKVVVFQRRSRETI 332 RR PRH S R +R + R P+ R PP R+ + + + RSR I Sbjct: 322 RRLRSPRHLSPRRDRGSPIRRRSPLPRRRLTPPRRMWSPPRRPQSLRHRSRSPI 375 >03_02_0740 - 10836752-10837052,10837756-10837814,10837901-10838476, 10839965-10841686,10841776-10842173,10842264-10842318, 10842989-10843048,10843444-10843540,10844885-10844955, 10845029-10845109,10846054-10846124,10847951-10848119, 10848521-10848683,10848752-10848942,10849037-10849168 Length = 1381 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 115 PPQSNSPPGSVLEPDHAVVLNGDE 186 P +NS P +V +PD +LNGDE Sbjct: 739 PTSNNSVPQNVDQPDSKKMLNGDE 762 >12_02_0077 - 13288916-13289659,13289689-13289691 Length = 248 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 379 ESSSTGSSFPADSPKPVPLAVVSLDSR 459 ++ S G S P DS + VP+ VV+L R Sbjct: 3 DNQSLGKSLPKDSRRHVPVGVVALKKR 29 >12_01_0655 + 5546293-5546478,5546760-5546877,5550697-5550776, 5551329-5552345,5552523-5553344,5553528-5553800 Length = 831 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = -3 Query: 723 CTTAVQRSAQNWHGQGESDCLIKTKHCDGPRGC*RNVISAQCS 595 C T RS N H + CL+ +H G NVI +CS Sbjct: 242 CDTERARSDTNEHNIYDGCCLLDVQHTQSFPGNGANVIPTKCS 284 >06_01_0437 + 3101449-3101521,3101872-3102232,3103766-3103958, 3104051-3104848,3104997-3105143,3106024-3106377 Length = 641 Score = 27.9 bits (59), Expect = 9.1 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = -2 Query: 238 GRTVFRSKR--AEW*RGGNARRRLKLPRDPVRGHCQAGSLTGA 116 G+T+ R R A W RG A RR +LP G +AG G+ Sbjct: 36 GQTLTRGPRTCAVWRRGRAAVRRRRLPAASAEGGAKAGRSLGS 78 >05_07_0113 + 27767826-27768284 Length = 152 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = -2 Query: 295 FIVSLLTRLGGTVRVDNIGGRTVFRSKRAEW*RGGNARRR 176 F+V LL+ +G VRV++ R +++R +W GN R R Sbjct: 58 FLVRLLSEIGLGVRVEDNRKRRPAKTRREDW--AGNRRGR 95 >04_04_0433 + 25163111-25163471,25163943-25164154,25164420-25164701, 25164794-25164916,25165511-25165664,25165754-25165965, 25166143-25166212,25166294-25166424 Length = 514 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 723 CTTAVQRSAQNWHGQGESDCLIKTKHCDGPRGC-*RNVISAQCS 595 CT++ +R A W G G L HC P V+S +CS Sbjct: 26 CTSSSRRRASPWGGAGRLIRLRLRGHCPSPASARAARVVSPRCS 69 >04_01_0416 - 5504415-5504590,5509032-5509116,5509190-5509322, 5509426-5510312 Length = 426 Score = 27.9 bits (59), Expect = 9.1 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +1 Query: 349 PLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDS 456 PL+ P AR SSTGSSFP S P ++ L S Sbjct: 47 PLIHPTPARF-ISSTGSSFPPYSEPPPSAPMLELGS 81 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,809,394 Number of Sequences: 37544 Number of extensions: 479173 Number of successful extensions: 1606 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1604 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -