BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0244 (749 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 23 3.1 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 22 7.1 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 22 7.1 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 7.1 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 21 9.3 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.3 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 23.0 bits (47), Expect = 3.1 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +3 Query: 258 TVPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVFFP 407 T+PP V K +V R+ E C ++ +QC + + FFP Sbjct: 96 TMPPEEVV--IGKEIVAVCRNEEYTGDDCQKTYQYVQCHYKQNPEKFFFP 143 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -1 Query: 338 VGDRFARSSLKNHYFHCFI 282 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -1 Query: 338 VGDRFARSSLKNHYFHCFI 282 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 310 SDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSP 420 +D R SP TP+ + Y +E+ + S F D+P Sbjct: 21 NDKRIYLSPR--TPIKNVYKNNIETKNQLSPFNIDTP 55 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/43 (23%), Positives = 19/43 (44%) Frame = +1 Query: 37 CPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHA 165 C +P S+ + L+ + + + Q NSP + P H+ Sbjct: 30 CTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHS 72 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 343 ATPLMSPYNARLESSSTGSSFP 408 A + SP + SSTGSS P Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,955 Number of Sequences: 438 Number of extensions: 4748 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -