BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0243 (774 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.74 SPCP1E11.08 |||ribosome biogenesis protein Nsa2 |Schizosaccharom... 27 2.3 SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Sc... 27 3.0 SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyce... 27 3.0 SPBP8B7.28c |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 27 3.9 SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic... 26 5.2 SPCC285.11 |ucp10||UBA/UAS domain protein Ucp10|Schizosaccharomy... 26 6.9 SPAC821.11 |pro1||gamma-glutamyl phosphate reductase Pro1 |Schiz... 26 6.9 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 6.9 SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|c... 26 6.9 SPAC2E12.02 |hsf1|hstf, hsf|transcription factor Hsf1|Schizosacc... 26 6.9 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 9.1 SPAC56F8.08 |mud1|ucp1, ddi1|UBA domain protein Mud1|Schizosacch... 25 9.1 SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|... 25 9.1 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.74 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 613 ARKIRGRPENAGPDPVRNVRRFSRV 539 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPCP1E11.08 |||ribosome biogenesis protein Nsa2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 260 Score = 27.5 bits (58), Expect = 2.3 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 618 LRLGRSAEGRRTRVRIQSE-T*DDFRECHIKYIQFLRPIILKY*LAKTNITHE 463 +R G+S + R+ ++ D F +KY +F+RP+ L+ K N+TH+ Sbjct: 136 IRTGKSKKNSWKRMITKATFVGDGFTRRPVKYERFIRPMALRQ--KKANVTHK 186 >SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 334 Score = 27.1 bits (57), Expect = 3.0 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 158 PWNPIEGRYGSEREEHRICGGVRILSADLENSVRDVRGDVAP 283 P+ P+EG Y + ++ HRI R A LE +R V+ P Sbjct: 3 PYEPVEGLYVNAKQYHRILKR-REARAKLEERLRGVQTTKKP 43 >SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 993 Score = 27.1 bits (57), Expect = 3.0 Identities = 18/81 (22%), Positives = 42/81 (51%), Gaps = 6/81 (7%) Frame = -1 Query: 441 AHPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALH-----LGDLLRIWVRTGA 277 +HP ++ R+ P+ N Y+ + + L + L + + +G ++ ++V +G+ Sbjct: 253 SHPFYMEQRYIPIGTTNTYTSASHGVLMLSSNGMEVLLRSTYIKYRMIGGIIDLFVYSGS 312 Query: 276 T-SPRTSLTEFSRSAESIRTP 217 T SP+ ++ ++ +SI TP Sbjct: 313 TVSPKYTIQQY---VQSIGTP 330 >SPBP8B7.28c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 215 Score = 26.6 bits (56), Expect = 3.9 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 675 RSAQNWHGQRESDCLIKTKHCDGLAGVDA 761 R N G+ ++DCLI C + G+D+ Sbjct: 25 RGTLNSKGKNDNDCLIMCMRCRKVKGIDS 53 >SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic subunit Bgs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1729 Score = 26.2 bits (55), Expect = 5.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 421 LDGKRMRRCRVWSMFVRYVRFSELVF*YNGPQKLYIFNMT 540 LDGK +RR R S + Y ++L + Y G Q++ + T Sbjct: 258 LDGKYVRRERDHSQIIGYDDINQLFWSYKGLQEIMCADKT 297 >SPCC285.11 |ucp10||UBA/UAS domain protein Ucp10|Schizosaccharomyces pombe|chr 3|||Manual Length = 427 Score = 25.8 bits (54), Expect = 6.9 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 585 FSGLPRIFLAVSRVGFVSCAIGTFCTT 665 FSGL ++++ +SRV +S I F TT Sbjct: 70 FSGLHKLWMILSRVPLISTFIPIFGTT 96 >SPAC821.11 |pro1||gamma-glutamyl phosphate reductase Pro1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 451 Score = 25.8 bits (54), Expect = 6.9 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Frame = +3 Query: 687 NWHGQRESDCLIKTKHCDG---LAGVDAS 764 N HG + +DC+I + +AG+DAS Sbjct: 341 NTHGSKHTDCIITSSEAAANRFMAGIDAS 369 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 6.9 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 210 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 73 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1274 Score = 25.8 bits (54), Expect = 6.9 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -1 Query: 627 RHDLRLG-RSAEGRRTRVRIQSET*DDFRECHIKYIQFLRPIILKY*LAKTNITHE 463 + D +LG + A + +V + S+ D +E H+KY+Q L+ LAK +I E Sbjct: 1053 KEDTKLGEKCANIVQLQVDLLSKLADQEKEKHLKYLQSSYKNSLEVQLAKLDIVKE 1108 >SPAC2E12.02 |hsf1|hstf, hsf|transcription factor Hsf1|Schizosaccharomyces pombe|chr 1|||Manual Length = 609 Score = 25.8 bits (54), Expect = 6.9 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -2 Query: 671 NGGRTECADRARNETDTTYG*EDPRKAGERGSGSSPKRK-TIFASVILNI 525 NGG + + + + G ++ G GSGSS RK T F++ + N+ Sbjct: 11 NGGTNQGMESSSANSPEMNGTQNSMSVGMSGSGSSQNRKITQFSNKLYNM 60 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 9.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 356 FPYLHYSID*RLFTLETCCGYGYEPARHL 270 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPAC56F8.08 |mud1|ucp1, ddi1|UBA domain protein Mud1|Schizosaccharomyces pombe|chr 1|||Manual Length = 332 Score = 25.4 bits (53), Expect = 9.1 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = -3 Query: 451 PGTGASASRPNP---TRPGPQSQSLFRSYGSNLPTSL 350 P + ASAS PNP TR G + + GS+ P SL Sbjct: 251 PASKASASSPNPQSGTRLGTKESVAPNNEGSSNPPSL 287 >SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1174 Score = 25.4 bits (53), Expect = 9.1 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = -1 Query: 387 YSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVRTGATSPRTSLTEFSRSAESIRTPPQM 208 Y + + L +P+L RL A+HLG +I ++ +P +T ++ + TPP + Sbjct: 1093 YKAKSSLLVTLKIPSLIPRLRAIHLGK-GKIVIK---KAPLKQITSKTKEKSTSPTPPSI 1148 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,321,326 Number of Sequences: 5004 Number of extensions: 72472 Number of successful extensions: 233 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 233 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 373338084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -