BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0243 (774 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 27 0.49 DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 1.5 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 3.4 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 4.5 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 27.5 bits (58), Expect = 0.49 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -1 Query: 711 RIPFVRASSELTVERRSYRMCRSRTKRNRHDLRLGRSAEGRRTRVRI 571 R+P ++E+ RR+Y + R R R D LG +GR+ R RI Sbjct: 1115 RLPPSPRTTEMRRRRRNYMQLQYR--RRRRDGELGDVPQGRQRRGRI 1159 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 131 NSSRTSRRRLQATL 90 NSSRT+ RRLQATL Sbjct: 350 NSSRTAIRRLQATL 363 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -2 Query: 440 RIRFPSKPDTPRSSEPILIPKLRIQFADFPYL 345 R+R + TP+ +++PKL+ + A P+L Sbjct: 5 RLRLITSFGTPQDKRTMVLPKLKDETAVMPFL 36 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.2 bits (50), Expect = 4.5 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -1 Query: 678 TVERRSYRMCRSRTKRNRHDLRLGRSAEGRRTRVRIQ 568 T RRS + R +RN H L R+ R V +Q Sbjct: 1037 TTHRRSQTLSPVRNERNYHTLTTTRTHSTERPFVAVQ 1073 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 861,833 Number of Sequences: 2352 Number of extensions: 19496 Number of successful extensions: 77 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -