BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0238 (754 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 1.1 AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A... 25 2.5 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.2 bits (55), Expect = 1.1 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 497 KGCQGIQPLIGSDRASSERF--QWYLVPDKNAATSEIFFYIYN 619 K C + PL GS ++ F QWYL + N T Y Y+ Sbjct: 553 KACP-LWPLCGSASRQTQTFTSQWYLNQEDNTDTGLRILYFYD 594 >AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A protein. Length = 433 Score = 25.0 bits (52), Expect = 2.5 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 536 RASSERFQWYLVPDKN 583 RA +E+F WY+ P+ N Sbjct: 213 RALAEKFDWYVFPNAN 228 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 759,724 Number of Sequences: 2352 Number of extensions: 15626 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -