BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0235 (804 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF260822-1|AAG02020.1| 138|Tribolium castaneum alpha-esterase l... 23 3.8 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 8.7 >AF260822-1|AAG02020.1| 138|Tribolium castaneum alpha-esterase like protein E3 protein. Length = 138 Score = 22.6 bits (46), Expect = 3.8 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = +2 Query: 167 VFANVLKRNRSVVKLFLFTRNFRFGTSSEQYLQRTLVHYTYFTKGSNS 310 +F + + + + L ++TRN G + Y +H YF GS + Sbjct: 43 LFRQKITGSENCLVLNVYTRNIPDGIHTSLYPVLVWIHGGYFIFGSGN 90 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 129 FYFSFYFVILFLLMLVVAIKVSFL*DVFC 43 FY++F + LL+LV ++ +FC Sbjct: 241 FYYAFILFTVHLLLLVCIYYFYYMHLLFC 269 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,744 Number of Sequences: 336 Number of extensions: 3883 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -