BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0235 (804 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 4.8 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 24 4.8 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.2 bits (50), Expect = 4.8 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 331 REFSSHFPASFDRLSRLISRHSIDSEISCG 420 REF S PA RL + RH DS S G Sbjct: 399 REFVSRPPACSTRLHCTMIRHDDDSNQSSG 428 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 129 FYFSFYFVILFLLMLVVAIKVSFL 58 FYF+ +LFL +L V+ + FL Sbjct: 601 FYFALLLTMLFLCVLPVSYAIVFL 624 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,956 Number of Sequences: 2352 Number of extensions: 14893 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -