BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0232 (571 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein;... 92 7e-18 UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG0... 56 4e-07 UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; ... 52 7e-06 UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella ve... 51 2e-05 UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n... 40 0.041 UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; ... 40 0.041 UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; ... 38 0.13 UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; ... 37 0.29 UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7; ... 36 0.51 UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative... 35 1.2 UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia scl... 35 1.5 UniRef50_A3B1W2 Cluster: Putative uncharacterized protein; n=4; ... 34 2.0 UniRef50_A4DID9 Cluster: Putative uncharacterized protein; n=10;... 33 3.6 UniRef50_A4HHL8 Cluster: Putative uncharacterized protein; n=3; ... 33 3.6 UniRef50_Q5KKC3 Cluster: Expressed protein; n=2; Filobasidiella ... 33 3.6 UniRef50_Q5BGW6 Cluster: Putative uncharacterized protein; n=1; ... 33 3.6 UniRef50_Q3W7D7 Cluster: Regulatory protein, TetR; n=1; Frankia ... 33 4.7 UniRef50_Q7RN96 Cluster: Putative senescence-associated protein;... 33 4.7 UniRef50_Q0UKE4 Cluster: Predicted protein; n=1; Phaeosphaeria n... 33 4.7 UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20; ... 33 4.7 UniRef50_Q161M8 Cluster: Sugar transferase domain protein; n=2; ... 33 6.2 UniRef50_UPI0001597497 Cluster: YkfC; n=1; Bacillus amyloliquefa... 32 8.2 UniRef50_UPI0000E8113C Cluster: PREDICTED: hypothetical protein;... 32 8.2 UniRef50_Q2LUB9 Cluster: Hypothetical membrane protein; n=1; Syn... 32 8.2 UniRef50_Q5KHX1 Cluster: Putative uncharacterized protein; n=1; ... 32 8.2 >UniRef50_Q9AVH2 Cluster: Putative senescence-associated protein; n=4; Eukaryota|Rep: Putative senescence-associated protein - Pisum sativum (Garden pea) Length = 282 Score = 92.3 bits (219), Expect = 7e-18 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = +1 Query: 373 HQ*GKTNLSHDGLNPAHVPF*WVNNPTLGEFCFAMIGRADIEGSKT 510 HQ GKTNLSHDGL PAHVP+ WVNNPTLGEFCF MIGRADIEGSK+ Sbjct: 57 HQWGKTNLSHDGLIPAHVPYWWVNNPTLGEFCFTMIGRADIEGSKS 102 Score = 42.7 bits (96), Expect = 0.006 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 504 KNNVAMTAWLPQAXYPCGNCS 566 K+NVAM AWLPQA YPCGN S Sbjct: 101 KSNVAMNAWLPQASYPCGNFS 121 >UniRef50_Q6QI74 Cluster: LRRG00134; n=6; Euteleostomi|Rep: LRRG00134 - Rattus norvegicus (Rat) Length = 221 Score = 56.4 bits (130), Expect = 4e-07 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +1 Query: 436 WVNNPTLGEFCFAMIGRADIEGSKT 510 WVNNPTLGEFCF MIGRADIEGSK+ Sbjct: 25 WVNNPTLGEFCFTMIGRADIEGSKS 49 Score = 37.9 bits (84), Expect = 0.17 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +3 Query: 504 KNNVAMTAWLPQAXYPCGNCS 566 K++VAM AW PQA YPCGN S Sbjct: 48 KSDVAMNAWPPQASYPCGNFS 68 >UniRef50_A4VF70 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 116 Score = 52.4 bits (120), Expect = 7e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 518 SDVVFDPSMSALPIIAKQNSPSVGLFTHQKGT 423 S ++FDPSMSALPII KQNS VGLFT Q+GT Sbjct: 85 STLLFDPSMSALPIIVKQNSQRVGLFTRQQGT 116 >UniRef50_A7RI48 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 746 Score = 51.2 bits (117), Expect = 2e-05 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -3 Query: 359 IVILLSTRGTAVSDIWFMHSAERPVVRSYH 270 +VILLSTRGTA SD W +H AE+P+VRSYH Sbjct: 660 VVILLSTRGTADSDNWHLHLAEKPMVRSYH 689 >UniRef50_UPI00006A2901 Cluster: UPI00006A2901 related cluster; n=1; Xenopus tropicalis|Rep: UPI00006A2901 UniRef100 entry - Xenopus tropicalis Length = 154 Score = 39.9 bits (89), Expect = 0.041 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +3 Query: 504 KNNVAMTAWLPQAXYPCGN 560 K+NVAM AWLPQA YPCG+ Sbjct: 11 KSNVAMNAWLPQASYPCGS 29 >UniRef50_Q3BKH8 Cluster: Putative uncharacterized protein; n=4; Bacteria|Rep: Putative uncharacterized protein - Magnetospirillum gryphiswaldense Length = 76 Score = 39.9 bits (89), Expect = 0.041 Identities = 20/34 (58%), Positives = 21/34 (61%) Frame = -1 Query: 496 RCRLFLSLRSKIRQALDCSPIKRERELGLDRRET 395 RCRL S Q CSPIK RELGL+RRET Sbjct: 4 RCRLITSWGWSRSQGFGCSPIKVVRELGLERRET 37 >UniRef50_Q4YZY1 Cluster: Putative uncharacterized protein; n=4; Eukaryota|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 54 Score = 38.3 bits (85), Expect = 0.13 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 448 DCSPIKRERELGLDRRET 395 DCSP RERELGLDRRET Sbjct: 6 DCSPANRERELGLDRRET 23 >UniRef50_Q4P3R9 Cluster: Putative uncharacterized protein; n=3; Dikarya|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 160 Score = 37.1 bits (82), Expect = 0.29 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = +3 Query: 519 MTAWLPQAXYPCGNCSG 569 M AWLPQA YPCGN SG Sbjct: 1 MNAWLPQASYPCGNFSG 17 >UniRef50_Q6L6Z3 Cluster: RRNA intron-encoded endonuclease; n=7; Archaea|Rep: RRNA intron-encoded endonuclease - Thermoproteus sp. IC-062 Length = 272 Score = 36.3 bits (80), Expect = 0.51 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = -2 Query: 495 DVGSSYHCEAKFAKRWIVHPSKGNVSWV*TVVRQVSFTL 379 DV SS+ A AK + P KGNV WV TV RQV L Sbjct: 228 DVVSSHPGGAAAAKGGVARPLKGNVRWVQTVARQVGLYL 266 >UniRef50_A5K5F4 Cluster: Senescence-associated protein, putative; n=1; Plasmodium vivax|Rep: Senescence-associated protein, putative - Plasmodium vivax Length = 131 Score = 35.1 bits (77), Expect = 1.2 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 504 KNNVAMTAWLPQAXYPCGNCS 566 K+ VA +AW PQA YPCGN S Sbjct: 11 KSYVARSAWQPQASYPCGNFS 31 >UniRef50_A7EB28 Cluster: Predicted protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Predicted protein - Sclerotinia sclerotiorum 1980 Length = 147 Score = 34.7 bits (76), Expect = 1.5 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +1 Query: 439 VNNPTLGEFCFAMIGRADIEGSK 507 VN+P L EFCF + RADIEGS+ Sbjct: 120 VNSPMLTEFCFGIRERADIEGSE 142 >UniRef50_A3B1W2 Cluster: Putative uncharacterized protein; n=4; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 486 Score = 34.3 bits (75), Expect = 2.0 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 321 GHLVHALGRAAGGAKLPSAGLCRTPLR 241 GH H +G AAGGA P G+ R PLR Sbjct: 352 GHGDHRVGAAAGGAAAPGGGMVRHPLR 378 >UniRef50_A4DID9 Cluster: Putative uncharacterized protein; n=10; Firmicutes|Rep: Putative uncharacterized protein - Listeria monocytogenes FSL N3-165 Length = 112 Score = 33.5 bits (73), Expect = 3.6 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = -2 Query: 495 DVGSSYHCEAKFAKRWIVHPSKGNVSWV*TVVRQ 394 DVGSS+ K W V P K + SWV VVRQ Sbjct: 68 DVGSSHPGAVVGPKGWAVRPLKRHASWVQNVVRQ 101 >UniRef50_A4HHL8 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania braziliensis Length = 489 Score = 33.5 bits (73), Expect = 3.6 Identities = 17/60 (28%), Positives = 30/60 (50%) Frame = -1 Query: 346 SVREEPQFRTFGSCTRPSGRWCEATIRGIMPNASKAEASLAESGKDMLTVEPRESGGSKQ 167 SV +E + + G C PS RW A++R + S + E+ D ++ ++GGS + Sbjct: 105 SVDKESEGESEGLCPSPSARWKRASLRAMRGRDSVPRLAATEARDDADEMDDIDNGGSDE 164 >UniRef50_Q5KKC3 Cluster: Expressed protein; n=2; Filobasidiella neoformans|Rep: Expressed protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 778 Score = 33.5 bits (73), Expect = 3.6 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = -2 Query: 360 DSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCRTPLRPKPA*PNPA 214 D ++ RS G LV LGR G KLP + +P RP+ P P+ Sbjct: 147 DQGDGGFDPERSLGRLVGELGRIIGDEKLPK--IPNSPFRPRSRSPLPS 193 >UniRef50_Q5BGW6 Cluster: Putative uncharacterized protein; n=1; Emericella nidulans|Rep: Putative uncharacterized protein - Emericella nidulans (Aspergillus nidulans) Length = 998 Score = 33.5 bits (73), Expect = 3.6 Identities = 23/51 (45%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = -1 Query: 271 IRGIMPNASKAEASLAE--SGKDMLTVEPRESGGSKQCDFTSRVSHSKRET 125 IRGIMP A + E S E SGK TV SGG + + S SKR T Sbjct: 643 IRGIMPQADRMEVSEQEITSGK-TFTVGASGSGGPSNVNISMEGSKSKRST 692 >UniRef50_Q3W7D7 Cluster: Regulatory protein, TetR; n=1; Frankia sp. EAN1pec|Rep: Regulatory protein, TetR - Frankia sp. EAN1pec Length = 220 Score = 33.1 bits (72), Expect = 4.7 Identities = 22/56 (39%), Positives = 27/56 (48%) Frame = -2 Query: 315 LVHALGRAAGGAKLPSAGLCRTPLRPKPA*PNPARICSLWSPESREALNNVTLLVA 148 L AL AA G P A L R L A P+P R+ LW+ RE + V L+A Sbjct: 72 LKEALDVAAVGDDEPVALLDRPWLEELTAEPDPVRVIELWTHGGREIMGRVAPLLA 127 >UniRef50_Q7RN96 Cluster: Putative senescence-associated protein; n=3; Eukaryota|Rep: Putative senescence-associated protein - Plasmodium yoelii yoelii Length = 205 Score = 33.1 bits (72), Expect = 4.7 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +3 Query: 498 RIKNNVAMTAWLPQAXYPCGN 560 R K+ VA AW PQA YPCG+ Sbjct: 9 RSKSYVAKNAWQPQASYPCGS 29 >UniRef50_Q0UKE4 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 298 Score = 33.1 bits (72), Expect = 4.7 Identities = 31/98 (31%), Positives = 42/98 (42%), Gaps = 5/98 (5%) Frame = -2 Query: 297 RAAGGAKLPSAGLCRTPLRPKPA*P--NPARICSLWSPESREALN---NVTLLVAFRIQN 133 RA G+K S G R + P P +P+ SL S + R + N++ + QN Sbjct: 50 RADRGSKTSSYGRGRDSVISHPFSPKQSPSPRSSLSSGDKRRHSSIPQNLSPTLVNDAQN 109 Query: 132 ARRDVEAHLDRGDRCYRFFS*HVHHGSEGPDITQFDVG 19 RR +AHLD Y H H GS D +D G Sbjct: 110 IRRPPQAHLDPEKHGYGSSKPHRHSGSTRSDEAVYDQG 147 >UniRef50_Q6C3D7 Cluster: Serine/threonine-protein kinase STE20; n=1; Yarrowia lipolytica|Rep: Serine/threonine-protein kinase STE20 - Yarrowia lipolytica (Candida lipolytica) Length = 1125 Score = 33.1 bits (72), Expect = 4.7 Identities = 22/69 (31%), Positives = 30/69 (43%) Frame = -2 Query: 306 ALGRAAGGAKLPSAGLCRTPLRPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR 127 A G + GA PSA P RP PA P + S+ +P S +T L AF + + Sbjct: 639 ASGDSGAGAAPPSAAPKSPPPRPPPA--PPLGVPSVHAPNSEYRQKMITQLEAFNAKRQQ 696 Query: 126 RDVEAHLDR 100 E H + Sbjct: 697 ERAERHAQK 705 >UniRef50_Q161M8 Cluster: Sugar transferase domain protein; n=2; Rhodobacteraceae|Rep: Sugar transferase domain protein - Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobactersp. (strain OCh 114)) (Roseobacter denitrificans) Length = 225 Score = 32.7 bits (71), Expect = 6.2 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 563 TVTTGITGLWQPGGHSDVVFD 501 ++T GITGLWQ G +DV +D Sbjct: 170 SMTPGITGLWQVSGRNDVTYD 190 >UniRef50_UPI0001597497 Cluster: YkfC; n=1; Bacillus amyloliquefaciens FZB42|Rep: YkfC - Bacillus amyloliquefaciens FZB42 Length = 299 Score = 32.3 bits (70), Expect = 8.2 Identities = 23/62 (37%), Positives = 29/62 (46%) Frame = +1 Query: 385 KTNLSHDGLNPAHVPF*WVNNPTLGEFCFAMIGRADIEGSKTTSL*PPGCHKPVIPVVTV 564 K+ LS DG + + P W+ PT F + G D+E S T L G K VVT Sbjct: 96 KSQLSKDGFHTSS-PAVWITKPTA--FLYHTNGEPDLEVSFLTRLSASGREKGFFRVVTP 152 Query: 565 LG 570 LG Sbjct: 153 LG 154 >UniRef50_UPI0000E8113C Cluster: PREDICTED: hypothetical protein; n=1; Gallus gallus|Rep: PREDICTED: hypothetical protein - Gallus gallus Length = 171 Score = 32.3 bits (70), Expect = 8.2 Identities = 21/50 (42%), Positives = 24/50 (48%) Frame = +3 Query: 192 GSTVSISLPDSARLASALEAFGIIPRMVASHHRPLGRVHEPNVRNCGSSR 341 G+T + PDS RL S + G PR ASH P G P R GS R Sbjct: 18 GTTAAPRPPDSPRLTSRRRSPGPPPRRAASHLVPAGGC-GPRPRGAGSRR 66 >UniRef50_Q2LUB9 Cluster: Hypothetical membrane protein; n=1; Syntrophus aciditrophicus SB|Rep: Hypothetical membrane protein - Syntrophus aciditrophicus (strain SB) Length = 90 Score = 32.3 bits (70), Expect = 8.2 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +3 Query: 105 PNGLRRRVSRFECETRLVKS--HCLEPPDSRGSTV 203 P+ ++R V + CE+R+ +S HCL P SRG+ + Sbjct: 31 PSYIKRGVPAYRCESRVGQSNFHCLNIPSSRGTEI 65 >UniRef50_Q5KHX1 Cluster: Putative uncharacterized protein; n=1; Filobasidiella neoformans|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 628 Score = 32.3 bits (70), Expect = 8.2 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -2 Query: 360 DSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCR-TPLR-PKPA*PNP 217 ++ A ++ RS G LV LGR G KLPS +P R P P NP Sbjct: 48 EAGDADFDPERSLGRLVDELGRVMGSDKLPSRPSSPFSPTRTPTPLGSNP 97 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 590,679,438 Number of Sequences: 1657284 Number of extensions: 11961273 Number of successful extensions: 33955 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 32888 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33941 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 38738010471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -