BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0232 (571 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 7.0 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 7.0 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 9.3 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 9.3 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.0 bits (47), Expect = 7.0 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -1 Query: 196 EPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRSM 89 + R GSK S + S+ E RR+P RSM Sbjct: 106 DARPRFGSKAAAANSSATSSESEDERRTPPQDMRSM 141 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.0 bits (47), Expect = 7.0 Identities = 11/32 (34%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = -2 Query: 324 FGHLVH-ALGRAAGGAKLPSAGLCRTPLRPKP 232 + L+H A+G GG L G C R P Sbjct: 936 YSFLMHTAVGHGGGGQSLSGPGSCLEDFRATP 967 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 22.6 bits (46), Expect = 9.3 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = -1 Query: 352 YCSVREEPQFRTFGSCTRPSGR-----WCEATIRGIM 257 YC ++ +F F S T P G+ W + + R I+ Sbjct: 395 YCGEEKDKEFLRFISSTAPDGKAKYQEWVQDSCRNIV 431 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 22.6 bits (46), Expect = 9.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 301 RPSGRWCEATIRGIMPNA 248 R S RWCE T+ ++ +A Sbjct: 363 RESCRWCECTLGDLIADA 380 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 603,563 Number of Sequences: 2352 Number of extensions: 11613 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -