BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0229 (787 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6254| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 1e-19 SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 3e-19 SB_22792| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 7e-18 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 86 4e-17 SB_12129| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 83 3e-16 SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_17342| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_16538| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 6e-16 SB_59131| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48941| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56722| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56542| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56484| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56050| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53318| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 80 2e-15 SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53107| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 80 2e-15 SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51655| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_49414| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48354| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46716| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44048| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43745| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43288| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42472| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41544| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40967| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_38493| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37958| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37636| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36504| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36156| Best HMM Match : Attractin (HMM E-Value=7) 80 2e-15 SB_36137| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.8) 80 2e-15 SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34993| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34853| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_33457| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_32499| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_32221| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_30769| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) 80 2e-15 SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_27143| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_25145| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_22308| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_21431| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_21073| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 80 2e-15 SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 80 2e-15 SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19514| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18889| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_18095| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_16836| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_16782| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_16534| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 80 2e-15 SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_9127| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_7297| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_7249| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4578| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4384| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4372| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_4161| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_3964| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_3637| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_3280| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_2782| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_2639| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_2564| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_2287| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_2150| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_1538| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_1504| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_788| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_721| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_574| Best HMM Match : PapG_N (HMM E-Value=8) 80 2e-15 SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_172| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_59785| Best HMM Match : TBCA (HMM E-Value=3) 80 2e-15 SB_59546| Best HMM Match : Collagen (HMM E-Value=0.003) 80 2e-15 SB_59242| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_59187| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_58964| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_58933| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_58264| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57917| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57878| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57788| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_57063| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56857| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56195| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56114| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 80 2e-15 SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_56094| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_55984| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_55844| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_55372| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_55221| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54670| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54625| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54410| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_54192| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53924| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53701| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53637| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53434| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52930| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52839| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52708| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52332| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_52026| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51920| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51767| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51579| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50997| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50914| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50695| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50427| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50404| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 80 2e-15 SB_50393| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_50189| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_49781| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_49101| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_49042| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48963| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48957| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48453| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_47917| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_47857| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_47720| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_47666| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_47427| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_47350| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46769| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46630| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46383| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46320| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_46081| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45834| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45450| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45197| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_45018| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44709| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44372| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44370| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 80 2e-15 SB_44174| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_44030| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_43572| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42784| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_42209| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41701| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41333| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41310| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41098| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_41064| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40781| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40467| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40329| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40121| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_40085| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_39718| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_39341| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_38278| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_38181| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37765| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37564| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37287| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_37073| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36965| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36869| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36786| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36725| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36657| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36394| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_36031| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_35815| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_35712| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_35515| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_35475| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_35434| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_35346| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_35321| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34616| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34583| Best HMM Match : Chlam_OMP3 (HMM E-Value=2.4) 80 2e-15 SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34397| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34379| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_34023| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_33416| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_33328| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_32361| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_32275| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_32014| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31990| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31973| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31926| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31716| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31547| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_31521| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_30641| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_30243| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_30141| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_29531| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_29169| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_28227| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_28224| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_27489| Best HMM Match : Pep_M12B_propep (HMM E-Value=4.7) 80 2e-15 SB_26909| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 >SB_6254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 94.3 bits (224), Expect = 1e-19 Identities = 49/87 (56%), Positives = 54/87 (62%) Frame = +1 Query: 499 QKASRYERLAATSQXXXXXXXXXXXXXXXYTKGSIGRAFAVPMRTEHLDQASFCPFAPRE 678 +K RYERLAATSQ TKGSIG AF V + TE+ +Q SF PF E Sbjct: 24 KKQRRYERLAATSQLSLWYFSDTSSLKLLKTKGSIGHAFTVCIHTENQNQVSFYPFVLHE 83 Query: 679 VSVLAELALGHLRYSLTDVPPQSNSPP 759 +SVL EL LGHLRY LTDVPPQ NS P Sbjct: 84 ISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 57.6 bits (133), Expect = 1e-08 Identities = 31/54 (57%), Positives = 32/54 (59%) Frame = +2 Query: 434 GEQSNAWRILLRNDRKSRHRRIKKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 GEQSN WRILLRNDRKSRHRRIKKQ + FS TS KL K Sbjct: 2 GEQSNTWRILLRNDRKSRHRRIKKQRRYERLAATSQLSLWYFSDTSSLKLLKTK 55 >SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 92.7 bits (220), Expect = 3e-19 Identities = 43/54 (79%), Positives = 44/54 (81%) Frame = +2 Query: 434 GEQSNAWRILLRNDRKSRHRRIKKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 GEQSN WRILLRNDRKSRHRRIKKQ +AWLPQASYPCGNFS TS KL K Sbjct: 2 GEQSNTWRILLRNDRKSRHRRIKKQRRYDAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 79.8 bits (188), Expect = 2e-15 Identities = 37/57 (64%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGS+G AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 >SB_22792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 88.2 bits (209), Expect = 7e-18 Identities = 49/87 (56%), Positives = 54/87 (62%) Frame = +1 Query: 499 QKASRYERLAATSQXXXXXXXXXXXXXXXYTKGSIGRAFAVPMRTEHLDQASFCPFAPRE 678 +K RYERLAATSQ TKGSIG AF V + TE+ +Q SF PF E Sbjct: 60 KKQRRYERLAATSQLSLCLKLLK-------TKGSIGHAFTVCIHTENQNQVSFYPFVLHE 112 Query: 679 VSVLAELALGHLRYSLTDVPPQSNSPP 759 +SVL EL LGHLRY LTDVPPQ NS P Sbjct: 113 ISVLIELTLGHLRYRLTDVPPQPNSQP 139 Score = 55.6 bits (128), Expect = 4e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +2 Query: 431 MGEQSNAWRILLRNDRKSRHRRIKKQ 508 +GEQSN WRILLRNDRKSRHRRIKKQ Sbjct: 37 VGEQSNTWRILLRNDRKSRHRRIKKQ 62 >SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) Length = 149 Score = 85.8 bits (203), Expect = 4e-17 Identities = 40/58 (68%), Positives = 44/58 (75%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NSPPG Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSPPG 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_12129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 84.2 bits (199), Expect = 1e-16 Identities = 39/57 (68%), Positives = 43/57 (75%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF P E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVPHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 83.4 bits (197), Expect = 2e-16 Identities = 39/57 (68%), Positives = 43/57 (75%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NSPP Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSPP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 51.6 bits (118), Expect = 7e-07 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGN+S TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNYSDTSSLKLLKTK 55 >SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 150 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKS 64 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 63 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94 >SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 150 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKS 64 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 63 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94 >SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 56.0 bits (129), Expect = 3e-08 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIE SKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIERSKS 25 Score = 54.0 bits (124), Expect = 1e-07 Identities = 25/34 (73%), Positives = 25/34 (73%) Frame = +2 Query: 494 RIKKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 R K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 22 RSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_17342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_16538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.2 bits (194), Expect = 4e-16 Identities = 38/58 (65%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGS+G AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.2 bits (194), Expect = 4e-16 Identities = 38/58 (65%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGS+G AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.2 bits (194), Expect = 4e-16 Identities = 39/57 (68%), Positives = 43/57 (75%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF RE+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLREISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.2 bits (194), Expect = 4e-16 Identities = 38/58 (65%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGS+G AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 81.8 bits (193), Expect = 6e-16 Identities = 39/58 (67%), Positives = 43/58 (74%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS PG Sbjct: 54 TKGSIGHAFTVCIPTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_59131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 81.0 bits (191), Expect = 1e-15 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGV 765 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P + Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDI 112 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.6 bits (190), Expect = 1e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVGIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_48941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.6 bits (190), Expect = 1e-15 Identities = 38/58 (65%), Positives = 42/58 (72%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPG 762 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHL Y LTDVPPQ NS PG Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLHYRLTDVPPQPNSQPG 98 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKS 26 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 25 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56 >SB_56722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_56542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_56484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_56050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_53318| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) Length = 120 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_53107| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) Length = 120 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_51655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_49414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_48354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 148 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKS 63 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 62 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 >SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_46716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSFFPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 149 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKS 64 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 63 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94 >SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_44048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_43745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_43288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_43021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKS 26 Score = 50.4 bits (115), Expect = 2e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGN S TS KL K Sbjct: 25 KSNVAMNAWLPQASYPCGNLSDTSSLKLLKTK 56 >SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_42472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_41544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 148 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKS 63 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 62 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 >SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_40967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 123 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 179 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 70 WVNNPTLGEFCFAMIGRADIEGSKS 94 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 93 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 124 >SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_38493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 58.0 bits (134), Expect = 8e-09 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 W+NNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WMNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_37958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_37636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_36504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_36156| Best HMM Match : Attractin (HMM E-Value=7) Length = 162 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 148 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKS 63 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 62 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 >SB_36137| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.8) Length = 127 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_34993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_34853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 149 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKS 64 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 63 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94 >SB_33457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNA LPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAGLPQASYPCGNFSDTSSLKLLKTK 42 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 471 MIGRADIEGSKSKSL*TLGCHKPVIPVVTF 560 MIGRADIEGSKS G + P F Sbjct: 1 MIGRADIEGSKSNVAMNAGLPQASYPCGNF 30 >SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_32499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 54.8 bits (126), Expect = 8e-08 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNP GEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPHFGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_32221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKS 26 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 25 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56 >SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_30769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 149 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKS 64 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 63 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 94 >SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) Length = 128 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_27143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 148 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKS 63 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 62 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 >SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_25145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 111 Score = 54.8 bits (126), Expect = 8e-08 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +3 Query: 435 VNNPTLGEFCFAMIGRADIEGSKS 506 VNNPTLGEFCFAMIGRADIEGSKS Sbjct: 3 VNNPTLGEFCFAMIGRADIEGSKS 26 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 25 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56 >SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_22505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 50.8 bits (116), Expect = 1e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS T KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTCSLKLLKTK 55 >SB_22308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Score = 51.2 bits (117), Expect = 9e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 438 NNPTLGEFCFAMIGRADIEGSKS 506 +NPTLGEFCFAMIGRADIEGSKS Sbjct: 3 DNPTLGEFCFAMIGRADIEGSKS 25 >SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 111 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKS 26 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 25 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 56 >SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_21431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 72 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 128 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 19 WVNNPTLGEFCFAMIGRADIEGSKS 43 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 42 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 73 >SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_21073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) Length = 128 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 206 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 262 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 153 WVNNPTLGEFCFAMIGRADIEGSKS 177 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 176 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 207 >SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 >SB_19514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 97 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 42 >SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 80.2 bits (189), Expect = 2e-15 Identities = 38/57 (66%), Positives = 42/57 (73%) Frame = +1 Query: 589 TKGSIGRAFAVPMRTEHLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPP 759 TKGSIG AF V + TE+ +Q SF PF E+SVL EL LGHLRY LTDVPPQ NS P Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 432 WVNNPTLGEFCFAMIGRADIEGSKS 506 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/32 (75%), Positives = 24/32 (75%) Frame = +2 Query: 500 KKQVAMNAWLPQASYPCGNFSGTSC*KLFILK 595 K VAMNAWLPQASYPCGNFS TS KL K Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 55 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,511,794 Number of Sequences: 59808 Number of extensions: 532205 Number of successful extensions: 3623 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3620 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -