BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0227 (862 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyce... 27 2.6 SPAC6F12.09 |rdp1|rdr1|RNA-directed RNA polymerase Rdp1|Schizosa... 26 6.0 >SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2310 Score = 27.5 bits (58), Expect = 2.6 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 562 YKIHLETFIVNGFASDINGKLYFSTPNDIFYINEDAGTL 678 +K+ E F++ +S NG+ Y P I +NE G L Sbjct: 61 FKLENEYFLLRQLSSHPNGRNYAIAPAYILLLNETLGAL 99 >SPAC6F12.09 |rdp1|rdr1|RNA-directed RNA polymerase Rdp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1215 Score = 26.2 bits (55), Expect = 6.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 316 ICKEFACDKLQHLANV 363 +CK CD+L HL NV Sbjct: 865 VCKAVRCDELMHLKNV 880 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,597,995 Number of Sequences: 5004 Number of extensions: 78722 Number of successful extensions: 214 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 214 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -