BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0221 (603 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26361| Best HMM Match : fn3 (HMM E-Value=0) 30 1.7 SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_26361| Best HMM Match : fn3 (HMM E-Value=0) Length = 1898 Score = 29.9 bits (64), Expect = 1.7 Identities = 27/74 (36%), Positives = 34/74 (45%), Gaps = 5/74 (6%) Frame = +2 Query: 257 LKLGSTTNPSNERIAYGDGVDKHTELVSWKFITLWENNRVYFKAHNTKYNQYLKMS---- 424 L+ GST S++ IA +T L S F R Y AH T Y YL +S Sbjct: 868 LESGSTLLASDDGIAPNKRTKVYTSLSSDVFY------RFYVYAHTT-YTTYLCLSVNAP 920 Query: 425 -TSTCNCNARDRVV 463 T C N+RDRV+ Sbjct: 921 CTQACRLNSRDRVL 934 >SB_18417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/53 (24%), Positives = 20/53 (37%) Frame = -1 Query: 159 CRPTACSSTPWCSVSCQ*SDC*LHFERCCPGLGSRIPSSYVQHCRSHR*GCCC 1 C+ CS++ C SC C L+ + + V C+S G C Sbjct: 224 CQQVVCSASGKCDQSCDGEGCNLYCSEGAKTCNQKCQGACVTDCKSRWCGVTC 276 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,383,238 Number of Sequences: 59808 Number of extensions: 347474 Number of successful extensions: 1321 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1321 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -