BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0221 (603 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase pr... 26 1.1 AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 23 7.6 >Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase protein. Length = 250 Score = 25.8 bits (54), Expect = 1.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 434 CNCNARDRVVYGGNSADSTREPW 502 C NA + + GG+ A+ R PW Sbjct: 1 CGTNANNSKIVGGHEAEIGRYPW 23 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 23.0 bits (47), Expect = 7.6 Identities = 11/36 (30%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 90 VVNNLIIDKRRNTMEYCYKLWVG-NGQDIVKKYFPL 194 ++N I+ + RN+ME+C G G +V++ P+ Sbjct: 85 LLNRKILQRLRNSMEHCMAGSGGLGGGAVVREALPI 120 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 583,130 Number of Sequences: 2352 Number of extensions: 12026 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -