BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0220 (715 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.3 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 9.9 AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 21 9.9 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.3 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -1 Query: 577 CAYCGKRKKSTKAPVF 530 C+Y G++K K P F Sbjct: 408 CSYTGEQKSRRKGPAF 423 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 129 IFVFCYYYAV*QVY 170 +FVFCY+ + VY Sbjct: 144 VFVFCYFIYLFTVY 157 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 21.0 bits (42), Expect = 9.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 494 KYEMSDISSFTVKHRSFCAFFSFSTVSAITLYKKTVF 604 K ++ D+SS R + + F S V+ LY+ VF Sbjct: 74 KIQVGDVSSVLKFIRKYGSHFIESYVTGNALYQVFVF 110 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,294 Number of Sequences: 336 Number of extensions: 3348 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -