BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0217 (593 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0327 + 27980841-27980972,27981673-27981763,27981848-279819... 29 2.1 03_05_0495 - 24907659-24908747 27 8.5 >02_05_0327 + 27980841-27980972,27981673-27981763,27981848-27981900, 27981990-27982154,27982544-27982662,27982880-27982997, 27983096-27983173,27983326-27983424 Length = 284 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -1 Query: 527 NFIYYFKIFFLLDFFELFSIEDYPQILKLEEYDPL 423 NFIYY + L LF + P L+L +Y PL Sbjct: 247 NFIYYLIVEILPSSLVLFILRRIPSKLRLAQYHPL 281 >03_05_0495 - 24907659-24908747 Length = 362 Score = 27.5 bits (58), Expect = 8.5 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 4/45 (8%) Frame = -2 Query: 202 YGSTFFIATGFHGIHVI----IGTLFLLICYIRHLNNHFSKNHHF 80 +GS FF+ T H I V+ + F L C I+ ++ + + H+F Sbjct: 238 FGSQFFVLTRKHAIMVVRDMKLWRKFKLPCLIKRRDSCYPEEHYF 282 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,218,967 Number of Sequences: 37544 Number of extensions: 179606 Number of successful extensions: 364 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -