BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0216 (285 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 1.7 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 3.9 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 1.7 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -2 Query: 221 CFKICLIFSITFRFLIYIYKFFVDFSY 141 C S FR+ + IY FF D S+ Sbjct: 320 CGSAIAYVSDVFRYGLLIYDFFKDSSF 346 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 20.6 bits (41), Expect = 3.9 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = -2 Query: 218 FKICLIFSITFRFLIYIYKFFVDFSYLLLDI 126 + C T ++ + +FF FS+L+L++ Sbjct: 346 YDTCCQGRATAIYIDKVSRFFFPFSFLILNV 376 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,193 Number of Sequences: 438 Number of extensions: 601 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 5619645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -