BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0212 (434 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z97055-2|CAI20388.1| 1501|Homo sapiens protein ( Human DNA seque... 30 3.0 Z82201-1|CAI20274.1| 1501|Homo sapiens protein ( Human DNA seque... 30 3.0 AL118498-1|CAI19709.1| 1501|Homo sapiens protein ( Human DNA seq... 30 3.0 AL031843-1|CAI19936.1| 1501|Homo sapiens protein ( Human DNA seq... 30 3.0 AL023801-1|CAI22791.1| 1501|Homo sapiens protein ( Human DNA seq... 30 3.0 BC057786-1|AAH57786.1| 512|Homo sapiens podocan-like 1 protein. 29 5.2 U12259-1|AAA80574.1| 283|Homo sapiens paired box homeotic prote... 29 9.1 U02368-1|AAC50053.1| 836|Homo sapiens PAX3 protein-forkhead tra... 29 9.1 U02309-1|AAA03628.1| 332|Homo sapiens PAX-3 protein. 29 9.1 U02308-1|AAA03627.1| 689|Homo sapiens protein ( Human PAX-3-FKH... 29 9.1 BC114363-1|AAI14364.1| 483|Homo sapiens paired box 3 protein. 29 9.1 BC101302-1|AAI01303.1| 483|Homo sapiens paired box 3 protein. 29 9.1 BC101301-1|AAI01302.1| 484|Homo sapiens paired box 3 protein. 29 9.1 BC101300-1|AAI01301.1| 483|Homo sapiens paired box 3 protein. 29 9.1 BC101299-1|AAI01300.1| 483|Homo sapiens paired box 3 protein. 29 9.1 AY251280-1|AAP13873.1| 407|Homo sapiens paired box 3 splice var... 29 9.1 AY251279-1|AAP13872.1| 403|Homo sapiens paired box 3 splice var... 29 9.1 >Z97055-2|CAI20388.1| 1501|Homo sapiens protein ( Human DNA sequence from clone RP3-388M5 on chromosome 22. ). Length = 1501 Score = 30.3 bits (65), Expect = 3.0 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = -2 Query: 346 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLTYIILSTRGSSPW 212 TG+ SK + R L+P R QF D L I LST G+ P+ Sbjct: 84 TGQNLTVSKSELRRIITDFLMPLTREQFQDVLAQIPLSTSGTVPY 128 >Z82201-1|CAI20274.1| 1501|Homo sapiens protein ( Human DNA sequence from clone RP3-345P10 on chromosome 22. ). Length = 1501 Score = 30.3 bits (65), Expect = 3.0 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = -2 Query: 346 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLTYIILSTRGSSPW 212 TG+ SK + R L+P R QF D L I LST G+ P+ Sbjct: 84 TGQNLTVSKSELRRIITDFLMPLTREQFQDVLAQIPLSTSGTVPY 128 >AL118498-1|CAI19709.1| 1501|Homo sapiens protein ( Human DNA sequence from clone RP1-185D5 on chromosome 22. ). Length = 1501 Score = 30.3 bits (65), Expect = 3.0 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = -2 Query: 346 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLTYIILSTRGSSPW 212 TG+ SK + R L+P R QF D L I LST G+ P+ Sbjct: 84 TGQNLTVSKSELRRIITDFLMPLTREQFQDVLAQIPLSTSGTVPY 128 >AL031843-1|CAI19936.1| 1501|Homo sapiens protein ( Human DNA sequence from clone RP1-246D7 on chromosome 22q13.1-13.33.ontains GSSs. ). Length = 1501 Score = 30.3 bits (65), Expect = 3.0 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = -2 Query: 346 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLTYIILSTRGSSPW 212 TG+ SK + R L+P R QF D L I LST G+ P+ Sbjct: 84 TGQNLTVSKSELRRIITDFLMPLTREQFQDVLAQIPLSTSGTVPY 128 >AL023801-1|CAI22791.1| 1501|Homo sapiens protein ( Human DNA sequence from clone RP4-786D3 on chromosome 22q13.31-33. ). Length = 1501 Score = 30.3 bits (65), Expect = 3.0 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = -2 Query: 346 TGRIRFPSKPDTPRSSEPILIPKLRIQFADFLTYIILSTRGSSPW 212 TG+ SK + R L+P R QF D L I LST G+ P+ Sbjct: 84 TGQNLTVSKSELRRIITDFLMPLTREQFQDVLAQIPLSTSGTVPY 128 >BC057786-1|AAH57786.1| 512|Homo sapiens podocan-like 1 protein. Length = 512 Score = 29.5 bits (63), Expect = 5.2 Identities = 23/66 (34%), Positives = 32/66 (48%) Frame = -3 Query: 291 SLFRSYGSNLPTSLPTLFYRLEALHLGDLLRIWVRTGATSPRTSLT*IFKVRREYPDTAA 112 SL + S LP SLP LE LHL + L V GA S +T L ++ + D+ Sbjct: 201 SLSNNQLSYLPPSLPP---SLERLHLQNNLISKVPRGALSRQTQLRELYLQHNQLTDSGL 257 Query: 111 NAVLFA 94 +A F+ Sbjct: 258 DATTFS 263 >U12259-1|AAA80574.1| 283|Homo sapiens paired box homeotic protein protein. Length = 283 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 353 TRHRPHPLPVQTRHAPVLRANPYS 282 T HRP PLP T H + +NP S Sbjct: 131 TVHRPQPLPPSTVHQSTIPSNPDS 154 >U02368-1|AAC50053.1| 836|Homo sapiens PAX3 protein-forkhead transcription factor fusion protein. Length = 836 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 353 TRHRPHPLPVQTRHAPVLRANPYS 282 T HRP PLP T H + +NP S Sbjct: 327 TVHRPQPLPPSTVHQSTIPSNPDS 350 >U02309-1|AAA03628.1| 332|Homo sapiens PAX-3 protein. Length = 332 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 353 TRHRPHPLPVQTRHAPVLRANPYS 282 T HRP PLP T H + +NP S Sbjct: 180 TVHRPQPLPPSTVHQSTIPSNPDS 203 >U02308-1|AAA03627.1| 689|Homo sapiens protein ( Human PAX-3-FKHR gene fusion mRNA, partial cds. ). Length = 689 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 353 TRHRPHPLPVQTRHAPVLRANPYS 282 T HRP PLP T H + +NP S Sbjct: 180 TVHRPQPLPPSTVHQSTIPSNPDS 203 >BC114363-1|AAI14364.1| 483|Homo sapiens paired box 3 protein. Length = 483 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 353 TRHRPHPLPVQTRHAPVLRANPYS 282 T HRP PLP T H + +NP S Sbjct: 326 TVHRPQPLPPSTVHQSTIPSNPDS 349 >BC101302-1|AAI01303.1| 483|Homo sapiens paired box 3 protein. Length = 483 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 353 TRHRPHPLPVQTRHAPVLRANPYS 282 T HRP PLP T H + +NP S Sbjct: 326 TVHRPQPLPPSTVHQSTIPSNPDS 349 >BC101301-1|AAI01302.1| 484|Homo sapiens paired box 3 protein. Length = 484 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 353 TRHRPHPLPVQTRHAPVLRANPYS 282 T HRP PLP T H + +NP S Sbjct: 327 TVHRPQPLPPSTVHQSTIPSNPDS 350 >BC101300-1|AAI01301.1| 483|Homo sapiens paired box 3 protein. Length = 483 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 353 TRHRPHPLPVQTRHAPVLRANPYS 282 T HRP PLP T H + +NP S Sbjct: 326 TVHRPQPLPPSTVHQSTIPSNPDS 349 >BC101299-1|AAI01300.1| 483|Homo sapiens paired box 3 protein. Length = 483 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 353 TRHRPHPLPVQTRHAPVLRANPYS 282 T HRP PLP T H + +NP S Sbjct: 326 TVHRPQPLPPSTVHQSTIPSNPDS 349 >AY251280-1|AAP13873.1| 407|Homo sapiens paired box 3 splice variant PAX3H protein. Length = 407 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 353 TRHRPHPLPVQTRHAPVLRANPYS 282 T HRP PLP T H + +NP S Sbjct: 327 TVHRPQPLPPSTVHQSTIPSNPDS 350 >AY251279-1|AAP13872.1| 403|Homo sapiens paired box 3 splice variant PAX3G protein. Length = 403 Score = 28.7 bits (61), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 353 TRHRPHPLPVQTRHAPVLRANPYS 282 T HRP PLP T H + +NP S Sbjct: 327 TVHRPQPLPPSTVHQSTIPSNPDS 350 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,776,407 Number of Sequences: 237096 Number of extensions: 1367471 Number of successful extensions: 3989 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 3843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3989 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3487985734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -