BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0210 (703 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 31 0.12 SPCP1E11.08 |||ribosome biogenesis protein Nsa2 |Schizosaccharom... 29 0.64 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.64 SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Sc... 27 2.6 SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyce... 27 3.4 SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr ... 26 4.5 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 6.0 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 7.9 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 7.9 SPBC14C8.02 |tim44||TIM23 translocase complex subunit Tim44|Schi... 25 7.9 SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|... 25 7.9 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 31.5 bits (68), Expect = 0.12 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +2 Query: 431 SGCGRCRVWSMFVRYVRFSELVF*YNRPQKLYIF 532 +GCG+ VW +VR+V F E + LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPCP1E11.08 |||ribosome biogenesis protein Nsa2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 260 Score = 29.1 bits (62), Expect = 0.64 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = -1 Query: 643 ARNETDTTLRLGRSAEGRRTRVRIQSE-T*DDFRECHIKYIQFLRPIILKY*LAKTNITH 467 A E +R G+S + R+ ++ D F +KY +F+RP+ L+ K N+TH Sbjct: 128 AEEEMFKVIRTGKSKKNSWKRMITKATFVGDGFTRRPVKYERFIRPMALRQ--KKANVTH 185 Query: 466 E 464 + Sbjct: 186 K 186 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.64 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 614 ARKIRGRPENAGPDPVRNVRRFSRV 540 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 334 Score = 27.1 bits (57), Expect = 2.6 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 158 PWNPIEGRYGSEREEHRICGGVRILSADLENSVRDVRGDVAP 283 P+ P+EG Y + ++ HRI R A LE +R V+ P Sbjct: 3 PYEPVEGLYVNAKQYHRILKR-REARAKLEERLRGVQTTKKP 43 >SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 993 Score = 26.6 bits (56), Expect = 3.4 Identities = 18/80 (22%), Positives = 41/80 (51%), Gaps = 6/80 (7%) Frame = -2 Query: 438 HPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALH-----LGDLLRIWVRTGAT 274 HP ++ R+ P+ N Y+ + + L + L + + +G ++ ++V +G+T Sbjct: 254 HPFYMEQRYIPIGTTNTYTSASHGVLMLSSNGMEVLLRSTYIKYRMIGGIIDLFVYSGST 313 Query: 273 -SPRTSLTEFSRSAESIRTP 217 SP+ ++ ++ +SI TP Sbjct: 314 VSPKYTIQQY---VQSIGTP 330 >SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 495 Score = 26.2 bits (55), Expect = 4.5 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -3 Query: 698 RASSELTVERRS-YRMCRSRTKRNRHDLTARKIRGRPENAGPDPVRNVRRFS 546 R S+ + RRS YR S + ++ ++L+ K + P + P P+ N+ + S Sbjct: 304 RRFSQSSYPRRSNYRRRISTSSKSLYELSPSKFKSIPITSNPPPMLNLSKGS 355 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 6.0 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -2 Query: 210 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 73 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 7.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 468 TNIDQTRHRPHPLPVQTRHAPV 403 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 7.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 356 FPYLHYSID*RLFTLETCCGYGYEPARHL 270 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPBC14C8.02 |tim44||TIM23 translocase complex subunit Tim44|Schizosaccharomyces pombe|chr 2|||Manual Length = 427 Score = 25.4 bits (53), Expect = 7.9 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +3 Query: 567 DWIRTRVLRPSADLPSRKVVSVSFRARSAHSVRPPFNGQLRTGTD 701 D + R+L+P+ D+P V V+FR + H + +G+L G D Sbjct: 346 DIMSQRLLQPN-DIP---VFIVTFRTQEVHMFKDASSGELVAGKD 386 >SPAC3A12.05c |taf2||TATA-binding protein associated factor Taf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1174 Score = 25.4 bits (53), Expect = 7.9 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = -2 Query: 387 YSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVRTGATSPRTSLTEFSRSAESIRTPPQM 208 Y + + L +P+L RL A+HLG +I ++ +P +T ++ + TPP + Sbjct: 1093 YKAKSSLLVTLKIPSLIPRLRAIHLGK-GKIVIK---KAPLKQITSKTKEKSTSPTPPSI 1148 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,040,111 Number of Sequences: 5004 Number of extensions: 65390 Number of successful extensions: 190 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -