BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0208 (741 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A3.17 |gef3||RhoGEF Gef3|Schizosaccharomyces pombe|chr 2||... 26 6.5 SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyc... 25 8.6 >SPBC29A3.17 |gef3||RhoGEF Gef3|Schizosaccharomyces pombe|chr 2|||Manual Length = 525 Score = 25.8 bits (54), Expect = 6.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 624 LCVLNIWIKPAFAFCSTR 677 LCV ++WIK A AF R Sbjct: 414 LCVTDVWIKKATAFSKRR 431 >SPAC11G7.02 |pub1||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 25.4 bits (53), Expect = 8.6 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = -2 Query: 575 ARGARKVTTGITGLWQPSVHSDVLFDPSMSALPIIAKQNSPSVGLFTHQKGT*AGFRPS* 396 A GAR T IT Q S S V +P+ S + N+P+ + + T + F Sbjct: 145 ASGARTQRTSITNDPQSSQSSSVSRNPASSRAGSPTRDNAPAASPASSEPRTFSSFEDQY 204 Query: 395 DRL 387 RL Sbjct: 205 GRL 207 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,010,478 Number of Sequences: 5004 Number of extensions: 60086 Number of successful extensions: 139 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -