BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0200 (720 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 24 4.1 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 24 4.1 Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein... 24 5.4 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 5.4 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 5.4 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 5.4 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 5.4 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 7.2 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 9.5 AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 23 9.5 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 24.2 bits (50), Expect = 4.1 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 19 LALRTGACRVWTGSGCGRCRVWSM 90 +++ G V G+ C C VWSM Sbjct: 5 ISVHVGQAGVQIGNPCWDCTVWSM 28 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 24.2 bits (50), Expect = 4.1 Identities = 16/76 (21%), Positives = 32/76 (42%) Frame = -2 Query: 419 IQSTGQKSHCVNTREGHRNALF*LDSRIPLVRASSELTVERRSYRIVPIAHETKPHDLTA 240 +Q + + + + R + LD + +RA ++L + RR I E KP ++ Sbjct: 342 VQDCADSATALGSEDQVRQEISVLDGKEAKIRADNDLLMGRRQELNQKIDTELKPEMMSI 401 Query: 239 RKIRGRPENAGPDPVR 192 + EN + +R Sbjct: 402 ERSIETIENVASNKLR 417 >Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein protein. Length = 192 Score = 23.8 bits (49), Expect = 5.4 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = -2 Query: 350 LDSRIPLVRASSELTVERRSYRIVPIAHETKPHDLTARKIRGRP 219 + + + L E V+ I+P A +KP D T + I +P Sbjct: 17 IGASVGLPTVDEENVVQAEQLPILPTADSSKPTDDTVKAIAPQP 60 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -2 Query: 83 QTRHRPHPLPVQTRHAPVLRANPYSEV 3 Q H PH Q +H P + P++ V Sbjct: 72 QLHHSPHQYHQQVQHQPQPPSTPFANV 98 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.8 bits (49), Expect = 5.4 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -2 Query: 83 QTRHRPHPLPVQTRHAPVLRANPYSEV 3 Q H PH Q +H P + P++ V Sbjct: 73 QLHHSPHQYHQQVQHQPQPPSTPFANV 99 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 5.4 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 500 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 390 D +F L RV TPA P +EFL + D + HC Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.8 bits (49), Expect = 5.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 307 PLNGGRTESCRSRTKRNRT 251 P +GGR SCRS R R+ Sbjct: 262 PRSGGRWPSCRSPPARRRS 280 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +1 Query: 205 GPAFSGLPRIFLAVRSCGFVSCAIGTILYD 294 G G +FL SC + C +G ++ D Sbjct: 350 GTQVIGTTEVFLDRESCRWCECTLGDLIAD 379 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 9.5 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = -3 Query: 274 SRTKRNRTTLRLG--RSAEGR 218 SRT R+R TLRL RS+ GR Sbjct: 991 SRTLRSRETLRLAQPRSSAGR 1011 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 323 HGQGESDCLI-KTKHCDGPRGC*RNVISAQC 412 +GQ ++D L+ + ++ DGP C R+ QC Sbjct: 95 YGQEKADELVARCRNNDGPDACERSFRLLQC 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 755,120 Number of Sequences: 2352 Number of extensions: 15414 Number of successful extensions: 35 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -