BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0200 (720 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC075858-1|AAH75858.1| 1253|Homo sapiens PLEKHG2 protein protein. 30 7.3 >BC075858-1|AAH75858.1| 1253|Homo sapiens PLEKHG2 protein protein. Length = 1253 Score = 30.3 bits (65), Expect = 7.3 Identities = 24/63 (38%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = -3 Query: 415 RALGRNHIASTPARAIAMLCFN*TVGFPLSVPV---LS*PLNGGRTESCRSRTKRNRTTL 245 R NH AS PA+A +L N P S PV L+ PL R RS T R T Sbjct: 304 RLFFENHPASIPAKAKQVLLENSLHCAPKSKPVLEPLTPPLGSPRPRDARSFTPGRRNTA 363 Query: 244 RLG 236 + G Sbjct: 364 KPG 366 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,102,068 Number of Sequences: 237096 Number of extensions: 2197665 Number of successful extensions: 5388 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5388 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8455186714 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -