BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0197 (741 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 25 0.75 S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating... 22 5.3 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 25.0 bits (52), Expect = 0.75 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 181 FNAVRRYLQNKR*YFVKIMQGQIDFDRNEFLHINTT 288 FN V +Y+ R +F++ M +DFD + + N T Sbjct: 3 FNNVIKYINFDRFFFIEGMTNVLDFDYYFYDYSNRT 38 >S78459-1|AAB34403.1| 50|Apis mellifera mast cell-degranulating peptide protein. Length = 50 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 45 MIAPHFCRSNCG 10 +I PH CR CG Sbjct: 36 VIKPHICRKICG 47 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,676 Number of Sequences: 438 Number of extensions: 2936 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -