BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0196 (734 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 26 1.1 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 23 7.4 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 26.2 bits (55), Expect = 1.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 310 FIGVNITFFPQHFLGLAGILDDIQIIQTHIFHE 212 F G+ + F + FL AG +DD +IQ + E Sbjct: 115 FFGLVMVCFVKCFLDKAGFIDDDGVIQQDVIRE 147 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 61 AGGKF*YHSIDDGRFKENKL 120 A GK+ YH DDG E L Sbjct: 121 ANGKYVYHDQDDGLLDERYL 140 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 523,527 Number of Sequences: 2352 Number of extensions: 9201 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -