BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0196 (734 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03110.1 68416.m00307 exportin 1, putative strong similarity ... 28 7.4 >At3g03110.1 68416.m00307 exportin 1, putative strong similarity to Exportin1 (XPO1) protein [Arabidopsis thaliana] GI:7671510; contains Pfam profile PF03810: Importin-beta N-terminal domain Length = 1076 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -2 Query: 331 KIQFFTIFIGVNITFFPQHFLGLAGILDDIQIIQTHIFHE 212 K +F + +G + F + GLA I+ D+Q Q H F+E Sbjct: 600 KRKFVIVQVGESEPFVSELLSGLATIVGDLQPHQIHTFYE 639 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,423,049 Number of Sequences: 28952 Number of extensions: 159676 Number of successful extensions: 283 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 283 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1614253080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -