BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0191 (670 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 4.0 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 9.1 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 9.1 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 532 LCEETHYDKNLFGLALSLRNI 470 L E+T YD L+G++ S + I Sbjct: 123 LSEDTFYDIRLWGVSFSKKQI 143 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/33 (27%), Positives = 16/33 (48%) Frame = +1 Query: 217 VRKLALSVQIAYSIWSAIASTKMWGYHSIHLTF 315 +R L+L + YS+ + W Y +LT+ Sbjct: 16 IRDLSLYFSVIYSLLRVKRMMRSWYYLLTNLTY 48 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 9.1 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 421 VFFLFNAVRRYLQNKR*YFVKIMQGQIDFYRNEFL 525 V+F FN+VR Q+ +++ Q +D R E L Sbjct: 97 VYFSFNSVRNVQQHTFADLIQLEQIHLDDNRIESL 131 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,556 Number of Sequences: 336 Number of extensions: 2660 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -