BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0191 (670 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36498| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-14) 29 4.5 SB_24408| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-17) 29 4.5 SB_40143| Best HMM Match : 7tm_1 (HMM E-Value=2.8e-09) 28 7.9 >SB_36498| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-14) Length = 596 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = -2 Query: 576 PCVFMKTNSIWHGSVYVKKLITIKIYLALHYLYEISPFILKVSSYSI 436 P V +++ ++ LI +KI L L ++Y I P ++ ++Y++ Sbjct: 408 PWVIALISTVMMSLGFIISLIPVKISLTLFFIYIILPLLIMSAAYTV 454 >SB_24408| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-17) Length = 439 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = -2 Query: 576 PCVFMKTNSIWHGSVYVKKLITIKIYLALHYLYEISPFILKVSSYSI 436 P V +++ ++ LI +KI L L ++Y I P ++ ++Y++ Sbjct: 211 PWVIALISTVMMSLGFIISLIPVKISLTLFFIYIILPLLIMSAAYTV 257 >SB_40143| Best HMM Match : 7tm_1 (HMM E-Value=2.8e-09) Length = 334 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -2 Query: 519 LITIKIYLALHYLYEISPFILKVSSYSI 436 LI +KI L L ++Y PF++ ++Y++ Sbjct: 165 LIPVKIILTLFFIYIFLPFLIMPAAYTV 192 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,609,894 Number of Sequences: 59808 Number of extensions: 293456 Number of successful extensions: 500 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -