BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0191 (670 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X82783-1|CAA58024.1| 173|Drosophila melanogaster serine:pyruvat... 29 4.3 AY094965-1|AAM11318.1| 812|Drosophila melanogaster SD07008p pro... 29 7.6 >X82783-1|CAA58024.1| 173|Drosophila melanogaster serine:pyruvate aminotransferase protein. Length = 173 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 Query: 523 ETHYDKNLFGLALSLRNITFYFEG 452 E HY + FG ALS ITF FEG Sbjct: 68 EVHYVEASFGRALSHEEITFAFEG 91 >AY094965-1|AAM11318.1| 812|Drosophila melanogaster SD07008p protein. Length = 812 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 140 TASLAAR*VNI-LTLYKFRLTFALSRKLENSH*AYRLRIQSGAQLLRQKCGAI 295 +A +AAR + I LY+F T L +++ H A+R + + L +KC + Sbjct: 493 SALMAARELEIQYPLYRFMWTCPLCQRMFEKHCAFRAHLTNKHDLTDEKCNVL 545 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,749,332 Number of Sequences: 53049 Number of extensions: 418217 Number of successful extensions: 753 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 753 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2889369000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -