BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0191 (670 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92812-6|CAB07280.1| 372|Caenorhabditis elegans Hypothetical pr... 28 6.9 Z81564-5|CAB04569.1| 656|Caenorhabditis elegans Hypothetical pr... 27 9.1 >Z92812-6|CAB07280.1| 372|Caenorhabditis elegans Hypothetical protein T03E6.6 protein. Length = 372 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -2 Query: 564 MKTNSIWHGSVYVKKLITIKIYLALHYLYEISPFI 460 ++ N W S Y+K L T I L + I PF+ Sbjct: 110 LQQNECWQNSTYLKCLTTFTINLIAEVINRIYPFL 144 >Z81564-5|CAB04569.1| 656|Caenorhabditis elegans Hypothetical protein K05C4.5 protein. Length = 656 Score = 27.5 bits (58), Expect = 9.1 Identities = 16/65 (24%), Positives = 35/65 (53%) Frame = -2 Query: 591 NIEKRPCVFMKTNSIWHGSVYVKKLITIKIYLALHYLYEISPFILKVSSYSIKKEKNSFM 412 NIE+ + + ++IW + + I + + ++ Y +++S ++ +SS S+ E F Sbjct: 67 NIERIKRIQISASTIWAACKHTENTIAMISHSSVLYFFDVSTKMI-ISSISLGVESRLF- 124 Query: 411 SISSN 397 +SSN Sbjct: 125 DVSSN 129 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,838,124 Number of Sequences: 27780 Number of extensions: 243341 Number of successful extensions: 403 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 403 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1508017654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -