BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0191 (670 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g44830.1 68415.m05582 protein kinase, putative similar to pro... 29 3.7 At5g38460.1 68418.m04649 ALG6, ALG8 glycosyltransferase family p... 28 6.5 >At2g44830.1 68415.m05582 protein kinase, putative similar to protein kinase PVPK-1 [Phaseolus vulgaris] SWISS-PROT:P15792 Length = 765 Score = 28.7 bits (61), Expect = 3.7 Identities = 9/26 (34%), Positives = 20/26 (76%) Frame = +3 Query: 231 TKRTDCVFNLERNCFDKNVGLSFNSF 308 T+R+D V ++++N FD+++ + +SF Sbjct: 280 TQRSDVVLSMDKNYFDRSISMVLDSF 305 >At5g38460.1 68418.m04649 ALG6, ALG8 glycosyltransferase family protein similar to SP|Q9Y672 Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase (EC 2.4.1.-) (Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase) {Homo sapiens}; contains Pfam profile PF03155: ALG6, ALG8 glycosyltransferase family Length = 533 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 532 LCEETHYDKNLFGLALSLRNITFYFEGIFLQH*KGK 425 LCE LF LALS + ++ YF F H GK Sbjct: 221 LCESEVLTCVLFSLALSHKQMSAYFAPAFFSHLLGK 256 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,652,158 Number of Sequences: 28952 Number of extensions: 207989 Number of successful extensions: 356 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 349 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 356 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -