BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0186 (601 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 1.8 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 29 2.4 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 29 2.4 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 3.1 At5g42370.1 68418.m05159 expressed protein 29 3.1 At2g19150.1 68415.m02235 pectinesterase family protein contains ... 29 3.1 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 4.1 At5g22390.1 68418.m02612 expressed protein 27 7.2 At2g25140.1 68415.m03007 heat shock protein 100, putative / HSP1... 27 7.2 At1g76110.1 68414.m08838 high mobility group (HMG1/2) family pro... 27 7.2 At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical... 27 7.2 At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-conta... 27 9.5 At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-conta... 27 9.5 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 27 9.5 At2g45560.1 68415.m05665 cytochrome P450 family protein 27 9.5 At2g05210.1 68415.m00549 expressed protein 27 9.5 At1g43950.1 68414.m05070 auxin-responsive factor, putative simil... 27 9.5 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 396 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 301 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -2 Query: 462 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 286 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -2 Query: 462 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 286 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 183 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 49 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 122 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 12 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At2g19150.1 68415.m02235 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 339 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 153 ICGGVRILSADLENSGEGCTWRCRAGSYPYPQQV 254 I GG+ + ++ EGCT + R G YP P +V Sbjct: 185 ISGGIDFIFGGAQSIFEGCTLKLRVGIYP-PNEV 217 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 178 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 80 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 57 ERSGKSFLFCLSVRVPWNPIEG 122 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At2g25140.1 68415.m03007 heat shock protein 100, putative / HSP100, putative / heat shock protein clpB, putative / HSP100/ClpB, putative similar to HSP100/ClpB GI:9651530 [Phaseolus lunatus] Length = 964 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 178 LRTLKIQVRDVRGDVAPVRTHIRSRSQGEEPLVDRIM*VREVGKLDP*LRNKD 336 ++ LK ++DVRGD + S+ Q E + + + GKLDP + D Sbjct: 214 IQVLKDAIKDVRGDQRVTDRNPESKYQALEKYGNDLTEMARRGKLDPVIGRDD 266 >At1g76110.1 68414.m08838 high mobility group (HMG1/2) family protein / ARID/BRIGHT DNA-binding domain-containing protein low similarity to high mobility group protein [Plasmodium falciparum] GI:790198; contains Pfam profiles PF00505: HMG (high mobility group) box, PF01388: ARID/BRIGHT DNA binding domain Length = 338 Score = 27.5 bits (58), Expect = 7.2 Identities = 20/69 (28%), Positives = 26/69 (37%) Frame = -1 Query: 286 LFYRLEALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEPYLPSIGF 107 L + E +HL T G P H +PS A TPP +R + P S F Sbjct: 120 LLFHYEQVHLFTARGPLLHPIATFHANPSTS-KEMALVEYTPPSIRYHNTHPPSQGSSSF 178 Query: 106 HGTRTLRQK 80 T+ K Sbjct: 179 TAIGTIEGK 187 >At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical to DNA Helicase [Arabidopsis thaliana] GI:11121449 Length = 1188 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 220 HLHVHPSPEFSRSAESIRTPPQMRCSSRSE 131 H H +P+ S S S+RTPP R +SR E Sbjct: 229 HYHSTSTPQPSVSNFSLRTPPVDRSASRLE 258 >At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 436 NSLKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 311 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 436 NSLKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 311 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +3 Query: 3 SLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 116 SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 47 SLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At2g45560.1 68415.m05665 cytochrome P450 family protein Length = 512 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 367 GREADAAGAGSGRCSCVMFVLAS*YFNIMRPQKLYIFNMTLAKIVLRSD 513 GR+ + G+GR C LA ++M LY F+ L K VL D Sbjct: 435 GRDYELTPFGAGRRICPGMPLAMKTVSLMLASLLYSFDWKLPKGVLSED 483 >At2g05210.1 68415.m00549 expressed protein Length = 364 Score = 27.1 bits (57), Expect = 9.5 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -1 Query: 178 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHFGLPR 23 +S T C+ +E Y +GF T TLR+KR L S +F PR Sbjct: 282 DSTATLEAFLCNKDAE-YFWGLGFQDTETLRKKRNWL--LGIRESSNFVAPR 330 >At1g43950.1 68414.m05070 auxin-responsive factor, putative similar to auxin response factor 9 [Arabidopsis thaliana] GI:4580575; contains Pfam profile PF02362: B3 DNA binding domain; non-consensus TT donor splice site at exon 5 Length = 222 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 460 QKLYIFNMTLAKIVLRSDWIRTRVLRPSADLPSRKSCR 573 +K+Y F ++V S L+P+ DLPS+ CR Sbjct: 44 EKVYYFPQGHIELVEASTREELNELQPNCDLPSKLQCR 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,972,483 Number of Sequences: 28952 Number of extensions: 305667 Number of successful extensions: 895 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 868 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -