BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0184 (693 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc... 28 1.1 SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosa... 27 3.4 >SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1463 Score = 28.3 bits (60), Expect = 1.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 612 WNVYRTFFVFLVFYTIFLYFCF 677 W VY T+F + IFLYF F Sbjct: 888 WKVYWTYFKACSLFLIFLYFLF 909 >SPCC338.13 |cog4||Golgi transport complex subunit Cog4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 738 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -1 Query: 222 KLYDALTNSIKWCTKLIHSIE*ARKCLLD*NELMHSER 109 K D N IK C + + ++CL D N MH ++ Sbjct: 85 KSVDREQNRIKECLLFVRQVRDFKECLQDLNRAMHHQQ 122 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,378,700 Number of Sequences: 5004 Number of extensions: 41868 Number of successful extensions: 109 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 109 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -